![[ICO]](/icons/blank.gif) | Name | Last modified | Size | Description |
|
![[SND]](/icons/sound2.gif) | Tren Sexual (letra) _ Pedro Suárez Vértiz (320 kbps).mp3 | 2022-08-13 04:02 | 0 | |
![[SND]](/icons/sound2.gif) | roxette - Itu0027s Possible Version One lyrics (YTCONVERT.IN).mp3 | 2022-08-13 04:01 | 0 | |
![[SND]](/icons/sound2.gif) | DJ_NO_COMMENT_TUTY_WIBOWO_SOUND_RULL_𝐏𝐑𝐄𝐒𝐄𝐓_VIRAL_FYP_T_n4HqwThT094 (1).mp3 | 2022-08-13 04:01 | 0 | |
![[SND]](/icons/sound2.gif) | OnlyMP3.to - Inscryption OST 23 - G0lly's Theme (Uploading)-WHi6TMmQaO0-192k-1643515093319.mp3 | 2022-08-13 04:00 | 0 | |
![[SND]](/icons/sound2.gif) | PALOMA AJENA - Aguamarina (YTCONVERT.IN).mp3 | 2022-08-13 04:00 | 0 | |
![[SND]](/icons/sound2.gif) | holiday.mp3 | 2022-08-13 03:58 | 1.1M | |
![[SND]](/icons/sound2.gif) | BDM.mp3 | 2022-08-13 03:57 | 0 | |
![[SND]](/icons/sound2.gif) | stack game bgm.mp3 | 2022-08-13 03:52 | 0 | |
![[SND]](/icons/sound2.gif) | No One Else.mp3 | 2022-08-13 03:49 | 0 | |
![[SND]](/icons/sound2.gif) | c3bdb5b8e5ebd8e9a8a84e38f84f879c.mp3 | 2022-08-13 03:48 | 0 | |
![[SND]](/icons/sound2.gif) | dem.mp3 | 2022-08-13 03:46 | 0 | |
![[SND]](/icons/sound2.gif) | Dj2.mp3 | 2022-08-13 03:44 | 2.4M | |
![[SND]](/icons/sound2.gif) | Until.mp3 | 2022-08-13 03:41 | 1.7M | |
![[SND]](/icons/sound2.gif) | mp21.mp3 | 2022-08-13 03:39 | 3.4M | |
![[SND]](/icons/sound2.gif) | black.mp3 | 2022-08-13 03:38 | 2.4M | |
![[SND]](/icons/sound2.gif) | mp18.mp3 | 2022-08-13 03:37 | 5.7M | |
![[SND]](/icons/sound2.gif) | ruok.mp3 | 2022-08-13 03:37 | 0 | |
![[SND]](/icons/sound2.gif) | regards.mp3 | 2022-08-13 03:35 | 0 | |
![[SND]](/icons/sound2.gif) | pal.mp3 | 2022-08-13 03:35 | 0 | |
![[SND]](/icons/sound2.gif) | sick.mp3 | 2022-08-13 03:35 | 0 | |
![[SND]](/icons/sound2.gif) | mp19.mp3 | 2022-08-13 03:33 | 136K | |
![[SND]](/icons/sound2.gif) | mp30.mp3 | 2022-08-13 03:31 | 0 | |
![[SND]](/icons/sound2.gif) | P.P.P.mp3 | 2022-08-13 03:31 | 0 | |
![[SND]](/icons/sound2.gif) | mixkit-message-pop-alert-2354.mp3 | 2022-08-13 03:30 | 46K | |
![[SND]](/icons/sound2.gif) | mp23.mp3 | 2022-08-13 03:30 | 0 | |
![[SND]](/icons/sound2.gif) | V4.mp3 | 2022-08-13 03:29 | 3.3M | |
![[SND]](/icons/sound2.gif) | mp22.mp3 | 2022-08-13 03:27 | 4.7M | |
![[SND]](/icons/sound2.gif) | BDM1.mp3 | 2022-08-13 03:27 | 104K | |
![[SND]](/icons/sound2.gif) | Dj1.mp3 | 2022-08-13 03:26 | 1.1M | |
![[SND]](/icons/sound2.gif) | Arms.mp3 | 2022-08-13 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | Abang.mp3 | 2022-08-13 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | Alsa.mp3 | 2022-08-13 03:19 | 0 | |
![[SND]](/icons/sound2.gif) | Lonte1.mp3 | 2022-08-13 03:19 | 0 | |
![[SND]](/icons/sound2.gif) | Kemerdekaan.mp3 | 2022-08-13 03:19 | 0 | |
![[SND]](/icons/sound2.gif) | SBD12.mp3 | 2022-08-13 03:19 | 0 | |
![[SND]](/icons/sound2.gif) | Funkot1.mp3 | 2022-08-13 03:18 | 0 | |
![[SND]](/icons/sound2.gif) | Enakniam12.mp3 | 2022-08-13 03:17 | 0 | |
![[SND]](/icons/sound2.gif) | andrew.mp3 | 2022-08-13 03:11 | 3.2M | |
![[VID]](/icons/movie.gif) | Lost (1).mp4 | 2022-08-13 03:08 | 0 | |
![[SND]](/icons/sound2.gif) | S6.mp3 | 2022-08-13 03:04 | 2.7M | |
![[SND]](/icons/sound2.gif) | S5.mp3 | 2022-08-13 03:04 | 3.3M | |
![[SND]](/icons/sound2.gif) | S3.mp3 | 2022-08-13 03:03 | 2.4M | |
![[SND]](/icons/sound2.gif) | S4.mp3 | 2022-08-13 03:03 | 3.6M | |
![[SND]](/icons/sound2.gif) | S2.mp3 | 2022-08-13 03:03 | 2.4M | |
![[SND]](/icons/sound2.gif) | S1.mp3 | 2022-08-13 03:03 | 1.5M | |
![[SND]](/icons/sound2.gif) | y2mate.com - Lagu Kemerdekaan RI 17 Agustus 1945.mp3 | 2022-08-13 03:01 | 168K | |
![[SND]](/icons/sound2.gif) | 20.mp3 | 2022-08-13 03:01 | 7.0M | |
![[SND]](/icons/sound2.gif) | Test.mp3 | 2022-08-13 02:56 | 256K | |
![[SND]](/icons/sound2.gif) | ROBBERY.mp3 | 2022-08-13 02:55 | 0 | |
![[SND]](/icons/sound2.gif) | stay.mp3 | 2022-08-13 02:49 | 2.4M | |
![[SND]](/icons/sound2.gif) | Moon.mp3 | 2022-08-13 02:49 | 3.5M | |
![[SND]](/icons/sound2.gif) | Last night.mp3 | 2022-08-13 02:48 | 0 | |
![[SND]](/icons/sound2.gif) | Gtw.mp3 | 2022-08-13 02:48 | 0 | |
![[SND]](/icons/sound2.gif) | kagome.mp3 | 2022-08-13 02:48 | 3.7M | |
![[SND]](/icons/sound2.gif) | Falz.mp3 | 2022-08-13 02:48 | 0 | |
![[SND]](/icons/sound2.gif) | VP7.mp3 | 2022-08-13 02:47 | 0 | |
![[SND]](/icons/sound2.gif) | Grandfather Time.mp3 | 2022-08-13 02:46 | 0 | |
![[SND]](/icons/sound2.gif) | 29_sua_01.mp3 | 2022-08-13 02:42 | 0 | |
![[SND]](/icons/sound2.gif) | 海伦 - 画离弦.mp3 | 2022-08-13 02:40 | 0 | |
![[SND]](/icons/sound2.gif) | Stay.mp3 | 2022-08-13 02:40 | 1.9M | |
![[SND]](/icons/sound2.gif) | LXSTODIUMmusic.mp3 | 2022-08-13 02:27 | 0 | |
![[SND]](/icons/sound2.gif) | pesni_dly_barvifi.mp3 | 2022-08-13 02:21 | 1.2M | |
![[SND]](/icons/sound2.gif) | mmk.mp3 | 2022-08-13 02:17 | 1.8M | |
![[SND]](/icons/sound2.gif) | asu.mp3 | 2022-08-13 02:17 | 1.5M | |
![[SND]](/icons/sound2.gif) | TakeMeHome.mp3 | 2022-08-13 02:08 | 0 | |
![[SND]](/icons/sound2.gif) | Maybe.mp3 | 2022-08-13 02:08 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.app - BURUH TANI - MARJINAL __ COVER BY REGITA ECHA (LYRIC) (64 kbps).mp3 | 2022-08-13 02:02 | 0 | |
![[SND]](/icons/sound2.gif) | fallen kingdom.mp3 | 2022-08-13 02:02 | 0 | |
![[SND]](/icons/sound2.gif) | lgw.mp3 | 2022-08-13 01:58 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - FUNABASHI DAYLIGHT ARCHIE COVER.mp3 | 2022-08-13 01:56 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - public domain archie edit_2.mp3 | 2022-08-13 01:55 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022- 26032022.mp3 | 2022-08-13 01:55 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - no name_2.mp3 | 2022-08-13 01:55 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - TECHENKO 200821.mp3 | 2022-08-13 01:55 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - FEDO - BE ORIGINAL (ARCHIE DUB).mp3 | 2022-08-13 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | Mb.mp3 | 2022-08-13 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - 27112021.mp3 | 2022-08-13 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - ARCHIE ID.mp3 | 2022-08-13 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - riverside.mp3 | 2022-08-13 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - fest_rozpruwacz_dupy.mp3 | 2022-08-13 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - ARCHIE FT EQUINOX LAST ONE TO DIE.mp3 | 2022-08-13 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - 01022022.mp3 | 2022-08-13 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - 27032022tech-pigeon.mp3 | 2022-08-13 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - 21112020.mp3 | 2022-08-13 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - 18112020 intro edm.mp3 | 2022-08-13 01:52 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - 02042022.mp3 | 2022-08-13 01:52 | 0 | |
![[SND]](/icons/sound2.gif) | لا تنسي الاشتراك في القناة.mp3 | 2022-08-13 01:45 | 0 | |
![[VID]](/icons/movie.gif) | QO.mp4 | 2022-08-13 01:43 | 0 | |
![[VID]](/icons/movie.gif) | Vp5.mp4 | 2022-08-13 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | QO.mp3 | 2022-08-13 01:37 | 2.8M | |
![[SND]](/icons/sound2.gif) | TOT.mp3 | 2022-08-13 01:36 | 0 | |
![[SND]](/icons/sound2.gif) | Vp5.mp3 | 2022-08-13 01:35 | 80K | |
![[SND]](/icons/sound2.gif) | TO.mp3 | 2022-08-13 01:34 | 4.3M | |
![[SND]](/icons/sound2.gif) | OT.mp3 | 2022-08-13 01:33 | 0 | |
![[SND]](/icons/sound2.gif) | TR.mp3 | 2022-08-13 01:30 | 200K | |
![[SND]](/icons/sound2.gif) | Vp7.mp3 | 2022-08-13 01:28 | 0 | |
![[SND]](/icons/sound2.gif) | big-baby-tape-kizaru-bandana-mp3.mp3 | 2022-08-13 01:27 | 0 | |
![[SND]](/icons/sound2.gif) | Vp6.mp3 | 2022-08-13 01:26 | 384K | |
![[SND]](/icons/sound2.gif) | Recording (5).mp3 | 2022-08-13 01:18 | 0 | |
![[SND]](/icons/sound2.gif) | Vp2.mp3 | 2022-08-13 01:18 | 2.0M | |
![[SND]](/icons/sound2.gif) | QC.mp3 | 2022-08-13 01:17 | 0 | |
![[SND]](/icons/sound2.gif) | QR.mp3 | 2022-08-13 01:16 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Rain Noise Rain Sound Effect No Copyright Nature Sounds720P HD.mp3 | 2022-08-13 01:15 | 0 | |
![[SND]](/icons/sound2.gif) | BM.mp3 | 2022-08-13 01:15 | 0 | |
![[SND]](/icons/sound2.gif) | sunrf.mp3 | 2022-08-13 01:12 | 0 | |
![[SND]](/icons/sound2.gif) | OQ.mp3 | 2022-08-13 01:11 | 1.3M | |
![[SND]](/icons/sound2.gif) | DO.mp3 | 2022-08-13 01:08 | 0 | |
![[SND]](/icons/sound2.gif) | DR.mp3 | 2022-08-13 01:07 | 0 | |
![[SND]](/icons/sound2.gif) | k10.mp3 | 2022-08-13 01:06 | 1.0M | |
![[SND]](/icons/sound2.gif) | DH.mp3 | 2022-08-13 01:05 | 0 | |
![[SND]](/icons/sound2.gif) | DD.mp3 | 2022-08-13 01:02 | 3.5M | |
![[SND]](/icons/sound2.gif) | DJ.mp3 | 2022-08-13 01:00 | 0 | |
![[SND]](/icons/sound2.gif) | k7.mp3 | 2022-08-13 00:51 | 0 | |
![[SND]](/icons/sound2.gif) | S23.mp3 | 2022-08-13 00:46 | 0 | |
![[SND]](/icons/sound2.gif) | S25.mp3 | 2022-08-13 00:46 | 0 | |
![[SND]](/icons/sound2.gif) | S24.mp3 | 2022-08-13 00:46 | 0 | |
![[SND]](/icons/sound2.gif) | S22.mp3 | 2022-08-13 00:46 | 0 | |
![[SND]](/icons/sound2.gif) | S21.mp3 | 2022-08-13 00:46 | 0 | |
![[SND]](/icons/sound2.gif) | S20.mp3 | 2022-08-13 00:46 | 0 | |
![[SND]](/icons/sound2.gif) | Faizan1.mp3 | 2022-08-13 00:43 | 0 | |
![[SND]](/icons/sound2.gif) | أغنية مضحكة أمازيغية(MP3_320K).mp3 | 2022-08-13 00:38 | 0 | |
![[SND]](/icons/sound2.gif) | k9.mp3 | 2022-08-13 00:37 | 5.1M | |
![[SND]](/icons/sound2.gif) | 2022.mp3 | 2022-08-13 00:35 | 3.5M | |
![[SND]](/icons/sound2.gif) | k8.mp3 | 2022-08-13 00:32 | 0 | |
![[SND]](/icons/sound2.gif) | tian.mp3 | 2022-08-13 00:24 | 0 | |
![[SND]](/icons/sound2.gif) | Mourad Majjoud - Jibi Police ( Ayli Ayli ) مراد مجود - جيبي البوليس(MP3_320K).mp3 | 2022-08-13 00:20 | 0 | |
![[SND]](/icons/sound2.gif) | d.mp3 | 2022-08-13 00:11 | 3.1M | |
![[SND]](/icons/sound2.gif) | BEN0.mp3 | 2022-08-13 00:11 | 0 | |
![[SND]](/icons/sound2.gif) | bellucci🇮🇹 _ inst_1nurovv - шахрезад «remix» (www.hotplayer.ru).mp3 | 2022-08-13 00:09 | 0 | |
![[SND]](/icons/sound2.gif) | prom.mp3 | 2022-08-13 00:09 | 1.8M | |
![[SND]](/icons/sound2.gif) | hamil.mp3 | 2022-08-13 00:08 | 1.7M | |
![[SND]](/icons/sound2.gif) | Cooking_ Great! - The Legend of Zelda_ Breath of the Wild Sound Effect (128 kbps).mp3 | 2022-08-13 00:08 | 0 | |
![[SND]](/icons/sound2.gif) | apakabarsayang.mp3 | 2022-08-13 00:06 | 0 | |
![[SND]](/icons/sound2.gif) | 19.mp3 | 2022-08-12 23:58 | 1.2M | |
![[SND]](/icons/sound2.gif) | samp.mp3 | 2022-08-12 23:52 | 4.1M | |
![[SND]](/icons/sound2.gif) | ToiMuonYeuMotNguoi-KhoiMy-5550418.mp3 | 2022-08-12 23:50 | 0 | |
![[SND]](/icons/sound2.gif) | shade rex.mp3 | 2022-08-12 23:42 | 0 | |
![[SND]](/icons/sound2.gif) | maanghang.mp3 | 2022-08-12 23:39 | 0 | |
![[SND]](/icons/sound2.gif) | M.I.B JAK.mp3 | 2022-08-12 23:34 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1660346521753.mp3 | 2022-08-12 23:25 | 0 | |
![[SND]](/icons/sound2.gif) | In Game Music Suite (Zuma Deluxe).mp3 | 2022-08-12 23:18 | 0 | |
![[SND]](/icons/sound2.gif) | Убей меня, Эйс! – Милая трагедия.mp3 | 2022-08-12 23:11 | 0 | |
![[SND]](/icons/sound2.gif) | ktt.mp3 | 2022-08-12 23:07 | 0 | |
![[SND]](/icons/sound2.gif) | vp10.mp3 | 2022-08-12 23:02 | 0 | |
![[SND]](/icons/sound2.gif) | Vp3.mp3 | 2022-08-12 22:57 | 2.5M | |
![[SND]](/icons/sound2.gif) | Hal18.mp3 | 2022-08-12 22:47 | 0 | |
![[SND]](/icons/sound2.gif) | akucoba.m4a | 2022-08-12 22:39 | 0 | |
![[SND]](/icons/sound2.gif) | misha-xramovi-vigimi-mp3.mp3 | 2022-08-12 22:32 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa61.mp3 | 2022-08-12 22:31 | 0 | |
![[SND]](/icons/sound2.gif) | tagne.mp3 | 2022-08-12 22:25 | 0 | |
![[SND]](/icons/sound2.gif) | Dere - Berisik (lirik).mp3 | 2022-08-12 22:23 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa4.mp3 | 2022-08-12 22:21 | 0 | |
![[SND]](/icons/sound2.gif) | Cover1.mp3 | 2022-08-12 22:21 | 0 | |
![[SND]](/icons/sound2.gif) | Cover2.mp3 | 2022-08-12 22:21 | 0 | |
![[SND]](/icons/sound2.gif) | manu_chao_me_gustas_tu_speed_up-mob4ik.com.mp3 | 2022-08-12 22:20 | 716K | |
![[SND]](/icons/sound2.gif) | ya.mp3 | 2022-08-12 22:20 | 3.0M | |
![[SND]](/icons/sound2.gif) | Budi Doremi - Melukis Senja (Official Video).mp3 | 2022-08-12 22:19 | 0 | |
![[SND]](/icons/sound2.gif) | CG5 — Mommy's Here (www.lightaudio.ru).mp3 | 2022-08-12 22:17 | 0 | |
![[SND]](/icons/sound2.gif) | cover2.mp3 | 2022-08-12 22:14 | 0 | |
![[SND]](/icons/sound2.gif) | cover1.mp3 | 2022-08-12 22:14 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa6.mp3 | 2022-08-12 22:11 | 0 | |
![[SND]](/icons/sound2.gif) | Audio Message M.mp3 | 2022-08-12 22:11 | 304K | |
![[SND]](/icons/sound2.gif) | Anthony Zhang.mp3 | 2022-08-12 22:05 | 0 | |
![[SND]](/icons/sound2.gif) | AZhangWhisky.mp3 | 2022-08-12 21:59 | 0 | |
![[SND]](/icons/sound2.gif) | AZhang.mp3 | 2022-08-12 21:55 | 0 | |
![[SND]](/icons/sound2.gif) | Jose ++Elvis Presley .mp3 | 2022-08-12 21:48 | 7.0M | |
![[SND]](/icons/sound2.gif) | Anthony Zhang 1.mp3 | 2022-08-12 21:43 | 0 | |
![[SND]](/icons/sound2.gif) | Aarne_Tesno_Feat_BUSHIDO_ZHO_ANIKV.mp3 | 2022-08-12 21:41 | 0 | |
![[SND]](/icons/sound2.gif) | DARK1.mp3 | 2022-08-12 21:40 | 0 | |
![[SND]](/icons/sound2.gif) | Matre-gims-bella_[www.Bisyor.me].mp3 | 2022-08-12 21:36 | 0 | |
![[SND]](/icons/sound2.gif) | nk.mp3 | 2022-08-12 21:33 | 0 | |
![[SND]](/icons/sound2.gif) | 1.mp3 | 2022-08-12 21:33 | 0 | |
![[SND]](/icons/sound2.gif) | morgenshtern-show-club-remix.mp3 | 2022-08-12 21:33 | 0 | |
![[SND]](/icons/sound2.gif) | Morgenshtern_Show_Sever_remix.mp3 | 2022-08-12 21:31 | 0 | |
![[SND]](/icons/sound2.gif) | Adam Lapierre Director of Wine Vint.mp3 | 2022-08-12 21:27 | 184K | |
![[SND]](/icons/sound2.gif) | VK.mp3 | 2022-08-12 21:25 | 2.4M | |
![[SND]](/icons/sound2.gif) | RR (1).mp3 | 2022-08-12 21:23 | 0 | |
![[SND]](/icons/sound2.gif) | RR.mp3 | 2022-08-12 21:23 | 2.1M | |
![[SND]](/icons/sound2.gif) | Anthony Zhang, Vinovest Cofounder CEO answering What has made whiskey one of the best-performing assets of 2022.mp3 | 2022-08-12 21:14 | 0 | |
![[SND]](/icons/sound2.gif) | JOMBLO2.mp3 | 2022-08-12 21:13 | 4.0K | |
![[SND]](/icons/sound2.gif) | murat-tkhagalegov-chuzhaja-nevesta.mp3 | 2022-08-12 21:04 | 0 | |
![[SND]](/icons/sound2.gif) | The Cad.mp3 | 2022-08-12 21:03 | 0 | |
![[SND]](/icons/sound2.gif) | Armağan Oruç - Gun Double.mp3 | 2022-08-12 20:58 | 0 | |
![[SND]](/icons/sound2.gif) | Мурат Тхагалегов - Чужая невеста (mp3store.cc).mp3 | 2022-08-12 20:55 | 0 | |
![[SND]](/icons/sound2.gif) | DINOAZ-1.mp3 | 2022-08-12 20:54 | 0 | |
![[SND]](/icons/sound2.gif) | Барбарики - PHONK REMIX (mp3-2020.com).mp3 | 2022-08-12 20:53 | 1.1M | |
![[SND]](/icons/sound2.gif) | DINO_AZ1.mp3 | 2022-08-12 20:51 | 0 | |
![[SND]](/icons/sound2.gif) | Duki - GIVENCHY x Hello Cotto ( Mashup ) ( DJ Hummer Remix ) .mp3 | 2022-08-12 20:44 | 0 | |
![[SND]](/icons/sound2.gif) | faydademo.mp3 | 2022-08-12 20:43 | 0 | |
![[SND]](/icons/sound2.gif) | Over_the_Horizon.mp3 | 2022-08-12 20:33 | 0 | |
![[SND]](/icons/sound2.gif) | PlayaPhonk_-_Phonky_Town_72969550.mp3 | 2022-08-12 20:33 | 0 | |
![[SND]](/icons/sound2.gif) | KSLV_Noh_-_Disaster_73210675.mp3 | 2022-08-12 20:32 | 0 | |
![[SND]](/icons/sound2.gif) | KSLV_Noh_-_Override_slowed_reverb_74103963.mp3 | 2022-08-12 20:32 | 0 | |
![[SND]](/icons/sound2.gif) | Jxid1.mp3 | 2022-08-12 20:31 | 0 | |
![[SND]](/icons/sound2.gif) | DISASTER_-_KSLV_Noh_slowed_reverb_320_kbps_73321634.mp3 | 2022-08-12 20:31 | 0 | |
![[SND]](/icons/sound2.gif) | MyBe1.mp3 | 2022-08-12 20:27 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Lil Uzi Vert 20 Min.mp3 | 2022-08-12 20:24 | 0 | |
![[SND]](/icons/sound2.gif) | Snoop_Dogg_Dr_Dre_-_Still_DRE_47964903.mp3 | 2022-08-12 20:23 | 10M | |
![[SND]](/icons/sound2.gif) | y2mate.com - Playboi Carti Sky Official Audio.mp3 | 2022-08-12 20:22 | 0 | |
![[SND]](/icons/sound2.gif) | Dj Azik - Chuchuka (mp3store.cc).mp3 | 2022-08-12 20:21 | 0 | |
![[SND]](/icons/sound2.gif) | Dj Azik - Chuchuka (mp3store.cc) (1).mp3 | 2022-08-12 20:19 | 0 | |
![[VID]](/icons/movie.gif) | audioclip-1659980429000-81000.mp4 | 2022-08-12 20:18 | 0 | |
![[SND]](/icons/sound2.gif) | vincent.mp3 | 2022-08-12 20:18 | 0 | |
![[SND]](/icons/sound2.gif) | danzakudurox.mp3 | 2022-08-12 20:11 | 0 | |
![[SND]](/icons/sound2.gif) | CuihX1.mp3 | 2022-08-12 20:10 | 0 | |
![[SND]](/icons/sound2.gif) | Три дня дождя - Неважно_(tropicmusic.ru).mp3 | 2022-08-12 20:08 | 0 | |
![[SND]](/icons/sound2.gif) | HayukLagu1.mp3 | 2022-08-12 20:07 | 0 | |
![[SND]](/icons/sound2.gif) | bili.mp3 | 2022-08-12 20:05 | 0 | |
![[SND]](/icons/sound2.gif) | KNOCK.mp3 | 2022-08-12 20:03 | 0 | |
![[SND]](/icons/sound2.gif) | MpE1.mp3 | 2022-08-12 20:01 | 0 | |
![[SND]](/icons/sound2.gif) | iniperludienter1 mp3_13-08-22_03-44-05-234.mp3 | 2022-08-12 20:01 | 0 | |
![[SND]](/icons/sound2.gif) | Три дня дождя - Неважно.mp3 | 2022-08-12 19:58 | 0 | |
![[SND]](/icons/sound2.gif) | yoreyes1.mp3 | 2022-08-12 19:54 | 0 | |
![[SND]](/icons/sound2.gif) | Don-Omar-feat-Tego-Calderon_-_Bandaleros-ost-Troynoy-forsazh-Tokiyskiy-drift_(mp3home.me).mp3 | 2022-08-12 19:48 | 0 | |
![[SND]](/icons/sound2.gif) | sasa.mp3 | 2022-08-12 19:44 | 0 | |
![[SND]](/icons/sound2.gif) | sasa1.mp3 | 2022-08-12 19:43 | 0 | |
![[SND]](/icons/sound2.gif) | Sokin1.mp3 | 2022-08-12 19:43 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - YG Toxic_320kbps.mp3 | 2022-08-12 19:42 | 0 | |
![[SND]](/icons/sound2.gif) | rub.mp3 | 2022-08-12 19:38 | 0 | |
![[SND]](/icons/sound2.gif) | Da.mp3 | 2022-08-12 19:33 | 0 | |
![[SND]](/icons/sound2.gif) | lana_del_rei_x_coolio_-_remix_sickick_(muzrecord.com).mp3 | 2022-08-12 19:32 | 6.4M | |
![[SND]](/icons/sound2.gif) | Aa.mp3 | 2022-08-12 19:32 | 7.3M | |
![[SND]](/icons/sound2.gif) | Aranc Qez.mp3 | 2022-08-12 19:31 | 0 | |
![[SND]](/icons/sound2.gif) | AUD-20220812-WA0017.m4a | 2022-08-12 19:31 | 0 | |
![[SND]](/icons/sound2.gif) | master.mp3 | 2022-08-12 19:27 | 0 | |
![[SND]](/icons/sound2.gif) | palak1.mp3 | 2022-08-12 19:26 | 0 | |
![[SND]](/icons/sound2.gif) | Byansi by Collins.mp3 | 2022-08-12 19:25 | 3.5M | |
![[SND]](/icons/sound2.gif) | collins- hellen mastered[HMRecords]0753486667.mp3 | 2022-08-12 19:23 | 0 | |
![[SND]](/icons/sound2.gif) | ℂ𝕦𝕓𝕒𝕖𝕤𝕤-🎟-kissvk.com.mp3 | 2022-08-12 19:22 | 0 | |
![[SND]](/icons/sound2.gif) | sentimental.mp3 | 2022-08-12 19:21 | 0 | |
![[SND]](/icons/sound2.gif) | Yoi1.mp3 | 2022-08-12 19:20 | 0 | |
![[SND]](/icons/sound2.gif) | BetterDays.mp3 | 2022-08-12 19:19 | 4.6M | |
![[VID]](/icons/movie.gif) | videoplayback.mp4 | 2022-08-12 19:19 | 4.0M | |
![[SND]](/icons/sound2.gif) | LostSky.mp3 | 2022-08-12 19:18 | 0 | |
![[SND]](/icons/sound2.gif) | Breezeblocks.mp3 | 2022-08-12 19:14 | 0 | |
![[SND]](/icons/sound2.gif) | Dark_Souls_OST_-_Sif_velikij_volk_(Gybka.com).mp3 | 2022-08-12 19:13 | 0 | |
![[SND]](/icons/sound2.gif) | Alt-J (∆) _ Breezeblocks Lyrics (HQ).mp3 | 2022-08-12 19:12 | 0 | |
![[SND]](/icons/sound2.gif) | FIL1.mp3 | 2022-08-12 19:12 | 0 | |
![[SND]](/icons/sound2.gif) | Dhije2.mp3 | 2022-08-12 19:11 | 3.9M | |
![[SND]](/icons/sound2.gif) | Sok3.mp3 | 2022-08-12 19:09 | 0 | |
![[SND]](/icons/sound2.gif) | Sok2.mp3 | 2022-08-12 19:04 | 0 | |
![[SND]](/icons/sound2.gif) | selamatulangtahun.mp3 | 2022-08-12 19:03 | 0 | |
![[SND]](/icons/sound2.gif) | Sokin2.mp3 | 2022-08-12 19:02 | 0 | |
![[SND]](/icons/sound2.gif) | MaMu2.mp3 | 2022-08-12 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | IUIH.mp3 | 2022-08-12 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | lucifer_call_me_devil.mp3 | 2022-08-12 18:49 | 0 | |
![[SND]](/icons/sound2.gif) | TryMitis.mp3 | 2022-08-12 18:48 | 0 | |
![[SND]](/icons/sound2.gif) | lucifer_call_me_devil_-5547512551233268271.mp3 | 2022-08-12 18:48 | 0 | |
![[SND]](/icons/sound2.gif) | Vr.mp3 | 2022-08-12 18:47 | 0 | |
![[SND]](/icons/sound2.gif) | Gustixa_-_lemon_tree(256k).mp3 | 2022-08-12 18:41 | 0 | |
![[SND]](/icons/sound2.gif) | 7063826647098641178.mp3 | 2022-08-12 18:39 | 0 | |
![[SND]](/icons/sound2.gif) | D GERRARD - นักวิทยาศาสตร์ (Scientist) (Lyrics).mp3 | 2022-08-12 18:38 | 0 | |
![[SND]](/icons/sound2.gif) | lukku11.mp3 | 2022-08-12 18:37 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Gellen Martadinata Selamat Ulang Tahun cover by Moyy.mp3 | 2022-08-12 18:37 | 0 | |
![[SND]](/icons/sound2.gif) | yt.mp3 | 2022-08-12 18:35 | 0 | |
![[SND]](/icons/sound2.gif) | !positive.mp3 | 2022-08-12 18:34 | 0 | |
![[SND]](/icons/sound2.gif) | Vp1.mp3 | 2022-08-12 18:33 | 80K | |
![[SND]](/icons/sound2.gif) | big-baby-tape-kizaru-so-icy-nihao-file.mp3 | 2022-08-12 18:29 | 0 | |
![[SND]](/icons/sound2.gif) | b13ftw.mp3 | 2022-08-12 18:26 | 0 | |
![[SND]](/icons/sound2.gif) | TOBA1.mp3 | 2022-08-12 18:25 | 424K | |
![[SND]](/icons/sound2.gif) | W.mp3 | 2022-08-12 18:22 | 3.5M | |
![[VID]](/icons/movie.gif) | Cukup Dikenang Saja.mp4 | 2022-08-12 18:22 | 0 | |
![[SND]](/icons/sound2.gif) | 4.mp3 | 2022-08-12 18:20 | 2.0M | |
![[SND]](/icons/sound2.gif) | DuaLipa.mp3 | 2022-08-12 18:18 | 0 | |
![[SND]](/icons/sound2.gif) | Платина feat OG Buda, MAYOT - Abu Dhabi Ba6y.mp3 | 2022-08-12 18:17 | 0 | |
![[SND]](/icons/sound2.gif) | 1234.mp3 | 2022-08-12 18:17 | 0 | |
![[SND]](/icons/sound2.gif) | 50.mp3 | 2022-08-12 18:15 | 0 | |
![[SND]](/icons/sound2.gif) | 123.mp3 | 2022-08-12 18:15 | 2.4M | |
![[SND]](/icons/sound2.gif) | 100.mp3 | 2022-08-12 18:15 | 3.3M | |
![[SND]](/icons/sound2.gif) | 111.mp3 | 2022-08-12 18:15 | 2.0M | |
![[SND]](/icons/sound2.gif) | 31.mp3 | 2022-08-12 18:14 | 1.5M | |
![[SND]](/icons/sound2.gif) | 29.mp3 | 2022-08-12 18:14 | 2.4M | |
![[SND]](/icons/sound2.gif) | 24.mp3 | 2022-08-12 18:14 | 144K | |
![[SND]](/icons/sound2.gif) | 25.mp3 | 2022-08-12 18:14 | 1.0M | |
![[SND]](/icons/sound2.gif) | 28.mp3 | 2022-08-12 18:14 | 2.0M | |
![[SND]](/icons/sound2.gif) | 26.mp3 | 2022-08-12 18:13 | 1.7M | |
![[SND]](/icons/sound2.gif) | 9.mp3 | 2022-08-12 18:13 | 2.4M | |
![[SND]](/icons/sound2.gif) | Whistle.mp3 | 2022-08-12 18:13 | 4.0M | |
![[SND]](/icons/sound2.gif) | Youth.mp3 | 2022-08-12 18:13 | 3.1M | |
![[SND]](/icons/sound2.gif) | 5.mp3 | 2022-08-12 18:13 | 1.1M | |
![[SND]](/icons/sound2.gif) | 0.mp3 | 2022-08-12 18:13 | 524K | |
![[SND]](/icons/sound2.gif) | Things.mp3 | 2022-08-12 18:13 | 4.3M | |
![[SND]](/icons/sound2.gif) | Tsinelas.mp3 | 2022-08-12 18:12 | 3.0M | |
![[SND]](/icons/sound2.gif) | Sweater.mp3 | 2022-08-12 18:12 | 4.3M | |
![[SND]](/icons/sound2.gif) | Stig.mp3 | 2022-08-12 18:12 | 4.8M | |
![[SND]](/icons/sound2.gif) | Thankyou.mp3 | 2022-08-12 18:12 | 3.4M | |
![[SND]](/icons/sound2.gif) | Theway.mp3 | 2022-08-12 18:12 | 2.8M | |
![[SND]](/icons/sound2.gif) | TeleportMe.mp3 | 2022-08-12 18:11 | 2.7M | |
![[SND]](/icons/sound2.gif) | Talk.mp3 | 2022-08-12 18:11 | 2.9M | |
![[SND]](/icons/sound2.gif) | slowly.mp3 | 2022-08-12 18:11 | 2.7M | |
![[SND]](/icons/sound2.gif) | Pogi.mp3 | 2022-08-12 18:11 | 4.1M | |
![[SND]](/icons/sound2.gif) | Staywithme.mp3 | 2022-08-12 18:11 | 1.9M | |
![[SND]](/icons/sound2.gif) | Peekaboo.mp3 | 2022-08-12 18:10 | 3.7M | |
![[SND]](/icons/sound2.gif) | PSG.mp3 | 2022-08-12 18:10 | 2.8M | |
![[SND]](/icons/sound2.gif) | Pahina.mp3 | 2022-08-12 18:10 | 5.2M | |
![[SND]](/icons/sound2.gif) | perfect.mp3 | 2022-08-12 18:10 | 2.3M | |
![[SND]](/icons/sound2.gif) | Own.mp3 | 2022-08-12 18:10 | 3.9M | |
![[SND]](/icons/sound2.gif) | Norem.mp3 | 2022-08-12 18:09 | 4.2M | |
![[SND]](/icons/sound2.gif) | Payday.mp3 | 2022-08-12 18:09 | 2.6M | |
![[SND]](/icons/sound2.gif) | Orasna.mp3 | 2022-08-12 18:09 | 2.6M | |
![[SND]](/icons/sound2.gif) | OneVoice.mp3 | 2022-08-12 18:09 | 2.5M | |
![[SND]](/icons/sound2.gif) | Letme.mp3 | 2022-08-12 18:09 | 3.5M | |
![[SND]](/icons/sound2.gif) | Loki.mp3 | 2022-08-12 18:09 | 2.9M | |
![[SND]](/icons/sound2.gif) | Kontrabida.mp3 | 2022-08-12 18:09 | 5.1M | |
![[SND]](/icons/sound2.gif) | Night.mp3 | 2022-08-12 18:08 | 2.8M | |
![[SND]](/icons/sound2.gif) | Nasasanay.mp3 | 2022-08-12 18:08 | 5.3M | |
![[SND]](/icons/sound2.gif) | big-baby-tape-kari.mp3 | 2022-08-12 18:08 | 0 | |
![[SND]](/icons/sound2.gif) | Me.mp3 | 2022-08-12 18:08 | 3.9M | |
![[SND]](/icons/sound2.gif) | big-baby-tape-kizaru-99-problems.mp3 | 2022-08-12 18:08 | 0 | |
![[SND]](/icons/sound2.gif) | jamik-samolet-mp3.mp3 | 2022-08-12 18:08 | 0 | |
![[SND]](/icons/sound2.gif) | marceline.mp3 | 2022-08-12 18:08 | 2.4M | |
![[SND]](/icons/sound2.gif) | Kings.mp3 | 2022-08-12 18:08 | 2.5M | |
![[SND]](/icons/sound2.gif) | Jamik_feat_ARCHI_Kupyury (1).mp3 | 2022-08-12 18:07 | 0 | |
![[SND]](/icons/sound2.gif) | TOBA2.mp3 | 2022-08-12 18:06 | 0 | |
![[SND]](/icons/sound2.gif) | big-baby-tape-kizaru-dirrt.mp3 | 2022-08-12 18:05 | 0 | |
![[SND]](/icons/sound2.gif) | omda1 (2).mp3 | 2022-08-12 18:03 | 0 | |
![[SND]](/icons/sound2.gif) | jnh.mp3 | 2022-08-12 18:01 | 0 | |
![[SND]](/icons/sound2.gif) | par.mp3 | 2022-08-12 17:59 | 0 | |
![[SND]](/icons/sound2.gif) | happy Birthday versi BT21🤗😂 #bt21🙏#hutri75.mp3 | 2022-08-12 17:59 | 4.0M | |
![[SND]](/icons/sound2.gif) | gor.mp3 | 2022-08-12 17:56 | 0 | |
![[SND]](/icons/sound2.gif) | ABBA - Mamma Mia (Jason Kokkovas Pop Punk cover).mp3 | 2022-08-12 17:54 | 0 | |
![[SND]](/icons/sound2.gif) | DJ BBHC PYRAMID SLOWED VIRAL TIKTOK (1).mp3 | 2022-08-12 17:54 | 0 | |
![[SND]](/icons/sound2.gif) | Onda Cero Entrevista 12 de agosto.mp3 | 2022-08-12 17:52 | 2.9M | |
![[SND]](/icons/sound2.gif) | taek.mp3 | 2022-08-12 17:50 | 233K | |
![[SND]](/icons/sound2.gif) | g6.mp3 | 2022-08-12 17:47 | 3.9M | |
![[SND]](/icons/sound2.gif) | เพลง.mp3 | 2022-08-12 17:41 | 0 | |
![[SND]](/icons/sound2.gif) | muli.mp3.mp3 | 2022-08-12 17:36 | 0 | |
![[SND]](/icons/sound2.gif) | RAY.mp3 | 2022-08-12 17:36 | 0 | |
![[SND]](/icons/sound2.gif) | Slava Marlow - Camry 3.5 (Right Version) ♂Gachi Remix♂ prod.Rat TV (ПЕРЕЗАЛИВ).mp3 | 2022-08-12 17:34 | 824K | |
![[SND]](/icons/sound2.gif) | ROGDJ.mp3 | 2022-08-12 17:30 | 0 | |
![[SND]](/icons/sound2.gif) | vp2.mp3 | 2022-08-12 17:30 | 3.4M | |
![[SND]](/icons/sound2.gif) | vp1.mp3 | 2022-08-12 17:30 | 4.9M | |
![[SND]](/icons/sound2.gif) | Anime_de_Japan_Torn_Apart_Bleach_OST_S_5Fn103TaY_3cef74cf.mp3 | 2022-08-12 17:30 | 0 | |
![[SND]](/icons/sound2.gif) | tpast.mp3.mp3 | 2022-08-12 17:29 | 0 | |
![[SND]](/icons/sound2.gif) | svt.mp3 | 2022-08-12 17:29 | 0 | |
![[SND]](/icons/sound2.gif) | TOBA4.mp3 | 2022-08-12 17:29 | 3.1M | |
![[VID]](/icons/movie.gif) | yt1s.com - غير وحدي مدمر نبغي نسكر عليها نهدر.mp4 | 2022-08-12 17:28 | 0 | |
![[SND]](/icons/sound2.gif) | ROG105.mp3 | 2022-08-12 17:26 | 0 | |
![[SND]](/icons/sound2.gif) | Tun.mp3 | 2022-08-12 17:25 | 0 | |
![[SND]](/icons/sound2.gif) | 3 Daqat - Abu Ft. Yousra ثلاث دقات - أبو و يسرا[Mpgun.com].mp3 | 2022-08-12 17:23 | 0 | |
![[SND]](/icons/sound2.gif) | wibuu.mp3 | 2022-08-12 17:22 | 0 | |
![[SND]](/icons/sound2.gif) | bilel laabidi - Sebt w lahad( rap tounsi ) الغناية الحدث 😂😂 [Mpgun.com].mp3 | 2022-08-12 17:21 | 0 | |
![[SND]](/icons/sound2.gif) | Last Child - DUKA (Official Lyric Video).mp3 | 2022-08-12 17:17 | 644K | |
![[SND]](/icons/sound2.gif) | Z9.mp3 | 2022-08-12 17:17 | 4.0M | |
![[SND]](/icons/sound2.gif) | face-yumorist-mp3.mp3 | 2022-08-12 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | Techno Ibiza 12-08-202WTF2 10-44.mp3 | 2022-08-12 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | Ungu1.mp3 | 2022-08-12 17:12 | 0 | |
![[SND]](/icons/sound2.gif) | luffy2.mp3 | 2022-08-12 17:11 | 0 | |
![[SND]](/icons/sound2.gif) | H2.mp3 | 2022-08-12 17:10 | 3.9M | |
![[SND]](/icons/sound2.gif) | Galau duka.mp3 | 2022-08-12 17:10 | 0 | |
![[SND]](/icons/sound2.gif) | Dj4.mp3 | 2022-08-12 17:10 | 1.2M | |
![[SND]](/icons/sound2.gif) | TOBA.mp3 | 2022-08-12 17:10 | 0 | |
![[SND]](/icons/sound2.gif) | luffy3.mp3 | 2022-08-12 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | Why This Kolaveri Di Dhanush 320kbps.mp3 | 2022-08-12 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | legoislandbuggy.mp3 | 2022-08-12 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | Lagnalu 2.0 Dj Govinda GR.mp3 | 2022-08-12 17:04 | 0 | |
![[SND]](/icons/sound2.gif) | k4.mp3 | 2022-08-12 17:01 | 4.0M | |
![[SND]](/icons/sound2.gif) | Payphone1.mp3 | 2022-08-12 16:58 | 2.4M | |
![[SND]](/icons/sound2.gif) | Пицца - Фары.mp3 | 2022-08-12 16:56 | 0 | |
![[SND]](/icons/sound2.gif) | DAVA & Kara Kross - Бум шакалака.mp3 | 2022-08-12 16:54 | 0 | |
![[SND]](/icons/sound2.gif) | as3.mp3 | 2022-08-12 16:53 | 3.6M | |
![[SND]](/icons/sound2.gif) | Swagging.mp3 | 2022-08-12 16:52 | 0 | |
![[SND]](/icons/sound2.gif) | Ghostface_Playa_-_Swaggin'_at_the_Partment(128k).mp3 | 2022-08-12 16:51 | 0 | |
![[SND]](/icons/sound2.gif) | Rave.mp3 | 2022-08-12 16:49 | 2.4M | |
![[SND]](/icons/sound2.gif) | k2.mp3 | 2022-08-12 16:47 | 4.0M | |
![[SND]](/icons/sound2.gif) | Baumwolle-Raffael-A-Speechelo.mp3 | 2022-08-12 16:42 | 0 | |
![[SND]](/icons/sound2.gif) | Baumwolle-Max-D-Murf.mp3 | 2022-08-12 16:39 | 0 | |
![[SND]](/icons/sound2.gif) | Cheb Mourad - Yahsarah Ki Kounti Tebghini يا حصراه مين كنتي تبغيني (Slowed Reverb)(MP3_128K).mp3 | 2022-08-12 16:39 | 0 | |
![[SND]](/icons/sound2.gif) | Baumwolle-Lukas-Talkia.mp3 | 2022-08-12 16:35 | 0 | |
![[SND]](/icons/sound2.gif) | badass.mp3 | 2022-08-12 16:33 | 0 | |
![[SND]](/icons/sound2.gif) | c1.mp3 | 2022-08-12 16:33 | 4.8M | |
![[SND]](/icons/sound2.gif) | Monster Ending 2 Make it home.mp3 | 2022-08-12 16:28 | 0 | |
![[SND]](/icons/sound2.gif) | ytmp3free.cc_uvi-pozdrav-brate-youtubemp3free.org.mp3 | 2022-08-12 16:26 | 0 | |
![[SND]](/icons/sound2.gif) | MIDNIGHT.mp3 | 2022-08-12 16:24 | 0 | |
![[SND]](/icons/sound2.gif) | anto23.mp3 | 2022-08-12 16:24 | 1.3M | |
![[SND]](/icons/sound2.gif) | Further West Presents The Blank Tapes Cherry Girl Live at Raven Sound Studio.mp3 | 2022-08-12 16:22 | 3.1M | |
![[SND]](/icons/sound2.gif) | Dhije1.mp3 | 2022-08-12 16:18 | 0 | |
![[SND]](/icons/sound2.gif) | proemquen.mp3 | 2022-08-12 16:17 | 0 | |
![[SND]](/icons/sound2.gif) | แว้นฟอร์มช่าง- 90s Supply (official MV) (1).mp3 | 2022-08-12 16:12 | 0 | |
![[SND]](/icons/sound2.gif) | Lesha_Svik_Malinoviy.mp3 | 2022-08-12 16:11 | 1.1M | |
![[SND]](/icons/sound2.gif) | 2021 YEAR END MASHUP - SUSH & YOHAN (BEST 130+ SONGS OF 2021).mp3 | 2022-08-12 16:07 | 11M | |
![[SND]](/icons/sound2.gif) | Ghostface.m4a | 2022-08-12 16:07 | 1.9M | |
![[SND]](/icons/sound2.gif) | Let Me Down Slowly x Kabhi Jo Badal Barse (Mashup) Alec Benjamin, Arijit Singh oddKidd.mp3 | 2022-08-12 16:06 | 2.8M | |
![[SND]](/icons/sound2.gif) | Petta - Marana Mass Official Video (Tamil) Rajinikanth Anirudh Ravichander.mp3 | 2022-08-12 16:06 | 3.2M | |
![[SND]](/icons/sound2.gif) | wes.mp3 | 2022-08-12 16:03 | 4.2M | |
![[SND]](/icons/sound2.gif) | Mugen Train Ost - Akaza vs Rengoku.mp3 | 2022-08-12 16:01 | 19M | |
![[SND]](/icons/sound2.gif) | anhky.mp3 | 2022-08-12 16:01 | 3.7M | |
![[SND]](/icons/sound2.gif) | Beeping.mp3 | 2022-08-12 16:01 | 0 | |
![[SND]](/icons/sound2.gif) | Playa7.mp3 | 2022-08-12 15:59 | 0 | |
![[SND]](/icons/sound2.gif) | Sick.mp3 | 2022-08-12 15:58 | 0 | |
![[SND]](/icons/sound2.gif) | Playaa.mp3 | 2022-08-12 15:58 | 0 | |
![[SND]](/icons/sound2.gif) | Playa.mp3 | 2022-08-12 15:58 | 0 | |
![[SND]](/icons/sound2.gif) | chay.mp3 | 2022-08-12 15:57 | 0 | |
![[SND]](/icons/sound2.gif) | DJ KU HAMIL DULUAN SUDAH 3 BULAN SOUND USAT PINT VIRAL FYP TIKTOK.mp3 | 2022-08-12 15:55 | 0 | |
![[SND]](/icons/sound2.gif) | Beach Bunny - Prom Queen (Official Video).mp3 | 2022-08-12 15:55 | 0 | |
![[SND]](/icons/sound2.gif) | pristine2.mp3 | 2022-08-12 15:51 | 0 | |
![[SND]](/icons/sound2.gif) | total.mp3 | 2022-08-12 15:51 | 37M | |
![[SND]](/icons/sound2.gif) | Aunt.mp3 | 2022-08-12 15:49 | 0 | |
![[SND]](/icons/sound2.gif) | INDRI.mp3 | 2022-08-12 15:48 | 0 | |
![[SND]](/icons/sound2.gif) | cj1.mp3 | 2022-08-12 15:47 | 0 | |
![[VID]](/icons/movie.gif) | tan2.mp4 | 2022-08-12 15:46 | 0 | |
![[SND]](/icons/sound2.gif) | Bruno.mp3 | 2022-08-12 15:46 | 3.9M | |
![[SND]](/icons/sound2.gif) | Queen.mp3 | 2022-08-12 15:45 | 2.1M | |
![[SND]](/icons/sound2.gif) | Am1.mp3 | 2022-08-12 15:44 | 0 | |
![[SND]](/icons/sound2.gif) | ejay2.mp3 | 2022-08-12 15:44 | 0 | |
![[SND]](/icons/sound2.gif) | memek.mp3 | 2022-08-12 15:43 | 0 | |
![[SND]](/icons/sound2.gif) | Sn.Mp.mp3 | 2022-08-12 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | sino.mp3 | 2022-08-12 15:40 | 0 | |
![[SND]](/icons/sound2.gif) | requestsino.mp3 | 2022-08-12 15:39 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.com - Jake Hill - dying lately (Full Album) (128 kbps).mp3 | 2022-08-12 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | the best Ukrainian songs - BUSHIDO ZHO - Водила чувствует мой вайб.mp3 | 2022-08-12 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | UNIQUE.mp3 | 2022-08-12 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | Nerve.mp3 | 2022-08-12 15:36 | 0 | |
![[SND]](/icons/sound2.gif) | Кореш feat. treepside - Толпа.mp3 | 2022-08-12 15:36 | 0 | |
![[SND]](/icons/sound2.gif) | pristine.mp3 | 2022-08-12 15:36 | 0 | |
![[SND]](/icons/sound2.gif) | Ytta.mp3 | 2022-08-12 15:35 | 0 | |
![[SND]](/icons/sound2.gif) | Beep.mp3 | 2022-08-12 15:35 | 0 | |
![[SND]](/icons/sound2.gif) | kavabanga Depo kolibri - Рассвело.mp3 | 2022-08-12 15:34 | 0 | |
![[SND]](/icons/sound2.gif) | Kolaveri D-Cypher -- (Sush _ Yohan Mashup)(MP3_128K).mp3 | 2022-08-12 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | miku.mp3 | 2022-08-12 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | sheesh.m4a | 2022-08-12 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | Fnatylqrd - Fed up..mp3 | 2022-08-12 15:30 | 0 | |
![[SND]](/icons/sound2.gif) | BANGSAD.mp3 | 2022-08-12 15:22 | 1.9M | |
![[SND]](/icons/sound2.gif) | crush.mp3 | 2022-08-12 15:22 | 3.3M | |
![[SND]](/icons/sound2.gif) | Jake_Hill_-_Stay_(Prod._CXDY)(256k).mp3 | 2022-08-12 15:19 | 0 | |
![[SND]](/icons/sound2.gif) | LAKEY INSPIRED - Chill Day.mp3 | 2022-08-12 15:17 | 0 | |
![[SND]](/icons/sound2.gif) | SAD.mp3 | 2022-08-12 15:15 | 0 | |
![[SND]](/icons/sound2.gif) | SBS.mp3 | 2022-08-12 15:14 | 0 | |
![[SND]](/icons/sound2.gif) | jo92.mp3 | 2022-08-12 15:13 | 0 | |
![[SND]](/icons/sound2.gif) | Narzzpro5.mp3 | 2022-08-12 15:09 | 0 | |
![[SND]](/icons/sound2.gif) | Jake Hill - nerve (Lyrics).mp3 | 2022-08-12 15:07 | 2.7M | |
![[SND]](/icons/sound2.gif) | law.mp3 | 2022-08-12 15:07 | 0 | |
![[SND]](/icons/sound2.gif) | MARNIK x Alfons x Pule - Harry Potter Style (Lyrics Video).mp3 | 2022-08-12 15:06 | 0 | |
![[SND]](/icons/sound2.gif) | Sino.mp3 | 2022-08-12 15:04 | 0 | |
![[SND]](/icons/sound2.gif) | Dandelions_-_Ruth_B_(Lyrics_+_Slow_Version)(256k).mp3 | 2022-08-12 15:04 | 0 | |
![[SND]](/icons/sound2.gif) | Kendrick Lamar.mp3 | 2022-08-12 15:03 | 0 | |
![[SND]](/icons/sound2.gif) | trees.mp3 | 2022-08-12 15:03 | 0 | |
![[SND]](/icons/sound2.gif) | alan.mp3 | 2022-08-12 15:02 | 0 | |
![[SND]](/icons/sound2.gif) | zaebispizdato.mp3 | 2022-08-12 15:02 | 0 | |
![[SND]](/icons/sound2.gif) | Jake Hill - Follow Me Into Hell (EP).mp3 | 2022-08-12 15:02 | 0 | |
![[SND]](/icons/sound2.gif) | Jake Hill - Hiding in the Dark.mp3 | 2022-08-12 15:00 | 0 | |
![[SND]](/icons/sound2.gif) | fdsfsdf.mp3 | 2022-08-12 15:00 | 0 | |
![[SND]](/icons/sound2.gif) | 1636722837_imagine-dragons-enemy-from-the-series-arcane-league-of-legends.mp3 | 2022-08-12 14:59 | 0 | |
![[SND]](/icons/sound2.gif) | y.mp3 | 2022-08-12 14:58 | 104K | |
![[SND]](/icons/sound2.gif) | Anrufbeantworter einer Irrenanstalt.mp3 | 2022-08-12 14:57 | 0 | |
![[SND]](/icons/sound2.gif) | Tik.mp3 | 2022-08-12 14:57 | 0 | |
![[SND]](/icons/sound2.gif) | yon.mp3 | 2022-08-12 14:57 | 0 | |
![[SND]](/icons/sound2.gif) | shadowraze_-_showdown_73909739.mp3 | 2022-08-12 14:56 | 4.7M | |
![[SND]](/icons/sound2.gif) | unnv-muza-mp3.mp3 | 2022-08-12 14:56 | 0 | |
![[SND]](/icons/sound2.gif) | iLOVEFRiDAY-Mia-Khalifa.mp3 | 2022-08-12 14:55 | 804K | |
![[SND]](/icons/sound2.gif) | sed.mp3 | 2022-08-12 14:54 | 950K | |
![[SND]](/icons/sound2.gif) | Dj Mbon.mp3 | 2022-08-12 14:52 | 0 | |
![[SND]](/icons/sound2.gif) | Lin.mp3 | 2022-08-12 14:52 | 0 | |
![[SND]](/icons/sound2.gif) | Sickomode.mp3 | 2022-08-12 14:52 | 1.2M | |
![[SND]](/icons/sound2.gif) | tom.mp3 | 2022-08-12 14:51 | 1.6M | |
![[SND]](/icons/sound2.gif) | - ⲋⲉⲭ ʀⲉⲙⲓⲭ _️ (1).mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - ⲋⲉⲭ ʀⲉⲙⲓⲭ _️ (1) (1).mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - Missчик.`.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | #Ắί₭Ǿ♫ - Дежавю.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - cексуально. `_.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - 86868.`__.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - Ба ба ба._`.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - _.`.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - ⲋⲉⲭ ʀⲉⲙⲓⲭ 🕊️.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - cause you are.` _.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - у меня в планах забрать тебя.`.mp3 | 2022-08-12 14:50 | 3.4M | |
![[SND]](/icons/sound2.gif) | sdhbet.mp3 | 2022-08-12 14:47 | 0 | |
![[SND]](/icons/sound2.gif) | Bf.mp3 | 2022-08-12 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | hatt.mp3 | 2022-08-12 14:45 | 0 | |
![[SND]](/icons/sound2.gif) | - - Corvette' (slow).mp3 | 2022-08-12 14:45 | 0 | |
![[SND]](/icons/sound2.gif) | BASS CLUB (автозвук) - Громкий фронт 323.mp3 | 2022-08-12 14:45 | 0 | |
![[SND]](/icons/sound2.gif) | (29)Migos - Racks 2 Skinny(Screwed By Artem).mp3 | 2022-08-12 14:44 | 0 | |
![[SND]](/icons/sound2.gif) | Growna.mp3.mp3 | 2022-08-12 14:43 | 1.5M | |
![[SND]](/icons/sound2.gif) | bubble.mp3 | 2022-08-12 14:41 | 0 | |
![[SND]](/icons/sound2.gif) | Lena_Raine_-_Pigstep_Minecraft_OST_69258249.mp3 | 2022-08-12 14:33 | 0 | |
![[SND]](/icons/sound2.gif) | Growna1.mp3 | 2022-08-12 14:28 | 0 | |
![[SND]](/icons/sound2.gif) | fukiangga.mp3 | 2022-08-12 14:28 | 0 | |
![[SND]](/icons/sound2.gif) | anggakul.mp3 | 2022-08-12 14:27 | 0 | |
![[SND]](/icons/sound2.gif) | Teger.mp3 | 2022-08-12 14:24 | 0 | |
![[SND]](/icons/sound2.gif) | b128453d3e6881d692e2ca81d1d3c94d.mp3 | 2022-08-12 14:24 | 0 | |
![[SND]](/icons/sound2.gif) | loginmusic.mp3 | 2022-08-12 14:22 | 0 | |
![[SND]](/icons/sound2.gif) | GR 1.MP3.mp3 | 2022-08-12 14:22 | 0 | |
![[SND]](/icons/sound2.gif) | link.mp3 | 2022-08-12 14:21 | 3.4M | |
![[SND]](/icons/sound2.gif) | twerk.mp3 | 2022-08-12 14:17 | 0 | |
![[SND]](/icons/sound2.gif) | mmmm.mp3 | 2022-08-12 14:17 | 0 | |
![[SND]](/icons/sound2.gif) | djmerahh.mp3 | 2022-08-12 14:16 | 0 | |
![[SND]](/icons/sound2.gif) | luffy.mp3 | 2022-08-12 14:14 | 3.0M | |
![[SND]](/icons/sound2.gif) | Chekele(PagalWorld).mp3 | 2022-08-12 14:13 | 0 | |
![[SND]](/icons/sound2.gif) | beast.mp3 | 2022-08-12 14:13 | 2.6M | |
![[SND]](/icons/sound2.gif) | Maid Dress GR.mp3 | 2022-08-12 14:13 | 0 | |
![[SND]](/icons/sound2.gif) | vortex1.mp3 | 2022-08-12 14:10 | 324K | |
![[SND]](/icons/sound2.gif) | Z6.mp3 | 2022-08-12 14:06 | 3.6M | |
![[SND]](/icons/sound2.gif) | Z1.mp3 | 2022-08-12 14:06 | 0 | |
![[SND]](/icons/sound2.gif) | tyes.mp3 | 2022-08-12 14:05 | 248K | |
![[SND]](/icons/sound2.gif) | Z5.mp3 | 2022-08-12 14:05 | 4.8M | |
![[SND]](/icons/sound2.gif) | Z4.mp3 | 2022-08-12 14:05 | 3.6M | |
![[SND]](/icons/sound2.gif) | Sannztuy.mp3 | 2022-08-12 14:05 | 1.7M | |
![[SND]](/icons/sound2.gif) | Z3.mp3 | 2022-08-12 14:05 | 2.4M | |
![[SND]](/icons/sound2.gif) | Z2.mp3 | 2022-08-12 14:05 | 4.1M | |
![[SND]](/icons/sound2.gif) | ASIKINbre.mp3 | 2022-08-12 14:02 | 0 | |
![[SND]](/icons/sound2.gif) | anton.mp3 | 2022-08-12 14:02 | 344K | |
![[SND]](/icons/sound2.gif) | applee.mp3 | 2022-08-12 14:02 | 0 | |
![[SND]](/icons/sound2.gif) | Kesariya.mp3 | 2022-08-12 14:01 | 0 | |
![[SND]](/icons/sound2.gif) | Bruno_Mars_-_It_Will_Rain_(Official_Music_Video)(128k).mp3 | 2022-08-12 14:00 | 0 | |
![[SND]](/icons/sound2.gif) | Dhijehh.mp3 | 2022-08-12 13:59 | 0 | |
![[SND]](/icons/sound2.gif) | thanhak.mp3 | 2022-08-12 13:58 | 0 | |
![[SND]](/icons/sound2.gif) | regge.mp3 | 2022-08-12 13:58 | 0 | |
![[SND]](/icons/sound2.gif) | santuybngst.mp3 | 2022-08-12 13:57 | 0 | |
![[SND]](/icons/sound2.gif) | Ravicks1.mp3 | 2022-08-12 13:56 | 0 | |
![[SND]](/icons/sound2.gif) | chifu.mp3 | 2022-08-12 13:55 | 0 | |
![[SND]](/icons/sound2.gif) | Ska.mp3 | 2022-08-12 13:54 | 0 | |
![[SND]](/icons/sound2.gif) | Ze4.mp3 | 2022-08-12 13:54 | 0 | |
![[SND]](/icons/sound2.gif) | Ze6.mp3 | 2022-08-12 13:54 | 0 | |
![[SND]](/icons/sound2.gif) | Ze5.mp3 | 2022-08-12 13:54 | 0 | |
![[SND]](/icons/sound2.gif) | Ze2.mp3 | 2022-08-12 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | KAMPANGGG.mp3 | 2022-08-12 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | ZE1.mp3 | 2022-08-12 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | ASUI.mp3 | 2022-08-12 13:51 | 0 | |
![[SND]](/icons/sound2.gif) | p3.mp3 | 2022-08-12 13:46 | 0 | |
![[SND]](/icons/sound2.gif) | Jin_Dogg_街風_feat_REAL_T_Official_Music_Vi.mp3 | 2022-08-12 13:44 | 0 | |
![[SND]](/icons/sound2.gif) | gta.mp3 | 2022-08-12 13:43 | 136K | |
![[SND]](/icons/sound2.gif) | astrea redux - timemachine [audiovk.com].mp3 | 2022-08-12 13:43 | 0 | |
![[SND]](/icons/sound2.gif) | A8.mp3 | 2022-08-12 13:42 | 0 | |
![[SND]](/icons/sound2.gif) | marcin_przybyowicz_-_a_story_you_wont_believe_(z2.fm).mp3 | 2022-08-12 13:39 | 0 | |
![[SND]](/icons/sound2.gif) | PANTEK.mp3 | 2022-08-12 13:38 | 0 | |
![[VID]](/icons/movie.gif) | 25145f62246bde9491eca32dde3e42dc.mp4 | 2022-08-12 13:37 | 0 | |
![[SND]](/icons/sound2.gif) | Caham.mp3 | 2022-08-12 13:36 | 0 | |
![[SND]](/icons/sound2.gif) | dj13.mp3 | 2022-08-12 13:36 | 0 | |
![[SND]](/icons/sound2.gif) | ASUII.mp3 | 2022-08-12 13:35 | 0 | |
![[SND]](/icons/sound2.gif) | andrewsad.mp3 | 2022-08-12 13:28 | 0 | |
![[SND]](/icons/sound2.gif) | toto.mp3 | 2022-08-12 13:26 | 3.0M | |
![[SND]](/icons/sound2.gif) | X2Download.com - Versi koplo Viral TikTok Okey Are you Ready lagu Thailand wong e e e e e wong e e e e e (128 kbps).mp3 | 2022-08-12 13:26 | 3.7M | |
![[SND]](/icons/sound2.gif) | za3im.mp3 | 2022-08-12 13:25 | 2.9M | |
![[SND]](/icons/sound2.gif) | Geoxor_-_Aurora_(Byfet.com).mp3 | 2022-08-12 13:24 | 0 | |
![[SND]](/icons/sound2.gif) | Y0VNG ZXR0 - Yandere ft. Ambi (Prod. Bughvvl)-1.mp3 | 2022-08-12 13:24 | 0 | |
![[SND]](/icons/sound2.gif) | Dj dermaga biru.mp3 | 2022-08-12 13:23 | 0 | |
![[SND]](/icons/sound2.gif) | YUNG-RARE _ KXLLSWXTCH ☢️ - TALIBAN DEADBEATVILLAIN.mp3 | 2022-08-12 13:23 | 0 | |
![[SND]](/icons/sound2.gif) | Lyova_Vlax_-_A_edet_katitsya_zanijena_priora.mp3 | 2022-08-12 13:22 | 0 | |
![[SND]](/icons/sound2.gif) | musik.mp3 | 2022-08-12 13:21 | 0 | |
![[SND]](/icons/sound2.gif) | Pop Smoke - Get Back (mp3store.cc).mp3 | 2022-08-12 13:21 | 0 | |
![[SND]](/icons/sound2.gif) | Skirii1.mp3 | 2022-08-12 13:18 | 0 | |
![[SND]](/icons/sound2.gif) | vortex.mp3 | 2022-08-12 13:17 | 0 | |
![[SND]](/icons/sound2.gif) | GeorgeM1.mp3 | 2022-08-12 13:17 | 0 | |
![[SND]](/icons/sound2.gif) | Vp9.mp3 | 2022-08-12 13:15 | 116K | |
![[SND]](/icons/sound2.gif) | POROJO.mp3 | 2022-08-12 13:14 | 0 | |
![[SND]](/icons/sound2.gif) | Galauu18.mp3 | 2022-08-12 13:14 | 0 | |
![[SND]](/icons/sound2.gif) | Dennz.mp3 | 2022-08-12 13:13 | 0 | |
![[SND]](/icons/sound2.gif) | DAY DAY.mp3 | 2022-08-12 13:13 | 0 | |
![[SND]](/icons/sound2.gif) | Pop Smoke - Get Back.mp3 | 2022-08-12 13:09 | 0 | |
![[SND]](/icons/sound2.gif) | $uicideboy$ - Fuck Boy Blood Bath.mp3 | 2022-08-12 13:06 | 0 | |
![[SND]](/icons/sound2.gif) | Chinx (OS) - Secrets Not Safe.mp3 | 2022-08-12 13:05 | 0 | |
![[SND]](/icons/sound2.gif) | 6.mp3 | 2022-08-12 13:05 | 40K | |
![[SND]](/icons/sound2.gif) | Ssinar.mp3 | 2022-08-12 13:02 | 0 | |
![[SND]](/icons/sound2.gif) | intheend.mp3 | 2022-08-12 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | Sinar.mp3 | 2022-08-12 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | DJ GODZILLA V2 SLOW REMIX viral FYP tiktok 2022🎶🎧.mp3 | 2022-08-12 12:59 | 0 | |
![[SND]](/icons/sound2.gif) | bodiev-kruzak-200-remix.mp3 | 2022-08-12 12:58 | 0 | |
![[SND]](/icons/sound2.gif) | Beach Bunny - Prom Queen (Speed Up) lyrics 🎶.mp3 | 2022-08-12 12:56 | 0 | |
![[SND]](/icons/sound2.gif) | 1..mp3 | 2022-08-12 12:56 | 0 | |
![[SND]](/icons/sound2.gif) | psovsk.mp3 | 2022-08-12 12:55 | 0 | |
![[SND]](/icons/sound2.gif) | DJ CLOSE YOUR EYE x BANGUN TIDUR SELFIE x GO SAMPE BAWAH VIRAL TIK TOK TERBARU 2022!!.mp3 | 2022-08-12 12:55 | 3.5M | |
![[SND]](/icons/sound2.gif) | 3.mp3 | 2022-08-12 12:54 | 2.1M | |
![[SND]](/icons/sound2.gif) | 2.mp3 | 2022-08-12 12:53 | 276K | |
![[SND]](/icons/sound2.gif) | Kandas15.mp3 | 2022-08-12 12:51 | 0 | |
![[SND]](/icons/sound2.gif) | ai_papai.mp3 | 2022-08-12 12:50 | 0 | |
![[SND]](/icons/sound2.gif) | Pesnya_Moj_drug_ms_bombil_tolko_legalno.mp3 | 2022-08-12 12:49 | 0 | |
![[SND]](/icons/sound2.gif) | Thinkdi.mp3 | 2022-08-12 12:46 | 0 | |
![[SND]](/icons/sound2.gif) | Shincan.mp3 | 2022-08-12 12:46 | 0 | |
![[SND]](/icons/sound2.gif) | until faond.mp3 | 2022-08-12 12:45 | 0 | |
![[SND]](/icons/sound2.gif) | oky.mp3 | 2022-08-12 12:38 | 0 | |
![[SND]](/icons/sound2.gif) | dan.mp3 | 2022-08-12 12:34 | 0 | |
![[SND]](/icons/sound2.gif) | kane.mp3 | 2022-08-12 12:33 | 2.8M | |
![[SND]](/icons/sound2.gif) | akankah.mp3 | 2022-08-12 12:32 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Romantic Happy Birthday Arranged by Miranda Wong Piano Cover.mp3 | 2022-08-12 12:30 | 0 | |
![[SND]](/icons/sound2.gif) | Vladimir Shaikin (_Blacksmith_) — It's Showtime! (Elias' Theme) (www.lightaudio.ru).mp3 | 2022-08-12 12:27 | 0 | |
![[SND]](/icons/sound2.gif) | A_cyplenok_pi-pi-piu_-_A_u_nas_zhivet_cyplenok_(iPleer.com).mp3 | 2022-08-12 12:26 | 0 | |
![[SND]](/icons/sound2.gif) | m23.mp3 | 2022-08-12 12:25 | 2.1M | |
![[SND]](/icons/sound2.gif) | Ghostemane - Bonesaw.mp3 | 2022-08-12 12:23 | 0 | |
![[SND]](/icons/sound2.gif) | vikram.mp3 | 2022-08-12 12:22 | 2.3M | |
![[SND]](/icons/sound2.gif) | iop.mp3 | 2022-08-12 12:22 | 0 | |
![[SND]](/icons/sound2.gif) | kal.mp3 | 2022-08-12 12:19 | 0 | |
![[SND]](/icons/sound2.gif) | zxc.mp3 | 2022-08-12 12:17 | 728K | |
![[SND]](/icons/sound2.gif) | omda2.mp3 | 2022-08-12 12:15 | 628K | |
![[SND]](/icons/sound2.gif) | fivem.mp3 | 2022-08-12 12:13 | 92K | |
![[SND]](/icons/sound2.gif) | Vp4.mp3 | 2022-08-12 12:10 | 2.2M | |
![[SND]](/icons/sound2.gif) | V-$-XV-PRiNCE_De_Lacure-Jyrigimdi.mp3 | 2022-08-12 12:02 | 1.3M | |
![[SND]](/icons/sound2.gif) | memay.mp3 | 2022-08-12 12:01 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa9.MP.mp3 | 2022-08-12 12:01 | 0 | |
![[SND]](/icons/sound2.gif) | DhikaSad8.MP.mp3 | 2022-08-12 12:01 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa8.mp3 | 2022-08-12 12:01 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa3.mp3 | 2022-08-12 12:00 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa2.mp3 | 2022-08-12 12:00 | 4.0M | |
![[SND]](/icons/sound2.gif) | Dhikaa5.mp3 | 2022-08-12 12:00 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa7.mp3 | 2022-08-12 12:00 | 0 | |
![[SND]](/icons/sound2.gif) | god.mp3 | 2022-08-12 11:59 | 16K | |
![[SND]](/icons/sound2.gif) | V $ X V PRiNCE, De Lacure - Жүрегімді.mp3 | 2022-08-12 11:57 | 0 | |
![[SND]](/icons/sound2.gif) | BO.mp3 | 2022-08-12 11:57 | 0 | |
![[SND]](/icons/sound2.gif) | Bakr_-_Status_dushi_73037819.mp3 | 2022-08-12 11:53 | 6.9M | |
![[SND]](/icons/sound2.gif) | KO.mp3 | 2022-08-12 11:53 | 1.1M | |
![[SND]](/icons/sound2.gif) | Mahika.mp3.mp3 | 2022-08-12 11:50 | 2.5M | |
![[SND]](/icons/sound2.gif) | MO.mp3 | 2022-08-12 11:50 | 4.6M | |
![[SND]](/icons/sound2.gif) | sex.mp3 | 2022-08-12 11:49 | 1.8M | |
![[SND]](/icons/sound2.gif) | TVアニメ『サクラクエスト』ノンクレジットOP/「Morning Glory」(K)NoW_NAME.mp3 | 2022-08-12 11:48 | 0 | |
![[SND]](/icons/sound2.gif) | omda3.mp3 | 2022-08-12 11:43 | 1.7M | |
![[SND]](/icons/sound2.gif) | KIRYa_NASVAEV_Matiz.mp3 | 2022-08-12 11:42 | 1.1M | |
![[SND]](/icons/sound2.gif) | loveuna.mp3 | 2022-08-12 11:41 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Rizkyfebian Selamat Ulang tahun Lyrics.mp3 | 2022-08-12 11:36 | 0 | |
![[SND]](/icons/sound2.gif) | odium.mp3 | 2022-08-12 11:36 | 0 | |
![[SND]](/icons/sound2.gif) | km.mp3 | 2022-08-12 11:35 | 2.4M | |
![[SND]](/icons/sound2.gif) | lop.mp3 | 2022-08-12 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | ______.mp3 | 2022-08-12 11:31 | 0 | |
![[SND]](/icons/sound2.gif) | Pik - Güzelsin (Turkish Trap)333.mp3 | 2022-08-12 11:30 | 0 | |
![[SND]](/icons/sound2.gif) | Shincandj.mp3 | 2022-08-12 11:30 | 0 | |
![[SND]](/icons/sound2.gif) | empire.mp3 | 2022-08-12 11:29 | 0 | |
![[SND]](/icons/sound2.gif) | Dr.Fresch_ Mina Knock _-_ Feedback_ -_ Feedback1.mp3 | 2022-08-12 11:26 | 0 | |
![[SND]](/icons/sound2.gif) | FreigrabeImpuls (DJ Cannabis Coffeeshops Deutschland).mp3 | 2022-08-12 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | Kopikap2.mp3 | 2022-08-12 11:23 | 0 | |
![[SND]](/icons/sound2.gif) | Dhije.mp3 | 2022-08-12 11:18 | 3.3M | |
![[SND]](/icons/sound2.gif) | Thinkdick.mp3 | 2022-08-12 11:18 | 0 | |
![[SND]](/icons/sound2.gif) | GREEY5.mp3 | 2022-08-12 11:17 | 0 | |
![[SND]](/icons/sound2.gif) | GREEY6.mp3 | 2022-08-12 11:17 | 0 | |
![[SND]](/icons/sound2.gif) | GREEY3.mp3 | 2022-08-12 11:17 | 0 | |
![[SND]](/icons/sound2.gif) | GREEY4.mp3 | 2022-08-12 11:17 | 0 | |
![[SND]](/icons/sound2.gif) | GREEY2.mp3 | 2022-08-12 11:17 | 0 | |
![[SND]](/icons/sound2.gif) | GREEY1.mp3 | 2022-08-12 11:16 | 0 | |
![[SND]](/icons/sound2.gif) | shesgone .mp3 | 2022-08-12 11:16 | 0 | |
![[SND]](/icons/sound2.gif) | Dj sikok bagi duo.mp3 | 2022-08-12 11:15 | 0 | |
![[SND]](/icons/sound2.gif) | Old Love - Yuji _ Putri Dahlia.mp3 | 2022-08-12 11:13 | 0 | |
![[SND]](/icons/sound2.gif) | A.mp3 | 2022-08-12 11:12 | 0 | |
![[SND]](/icons/sound2.gif) | dingdut1.mp3 | 2022-08-12 11:11 | 0 | |
![[SND]](/icons/sound2.gif) | DhikaSad (1).mp3 | 2022-08-12 11:05 | 1.2M | |
![[SND]](/icons/sound2.gif) | ilham11.mp3 | 2022-08-12 11:03 | 1.9M | |
![[SND]](/icons/sound2.gif) | wtf.mp3 | 2022-08-12 11:03 | 1.6M | |
![[SND]](/icons/sound2.gif) | Смешарики - От Винта (Bass Boosted By Лампочка 30db) (mp3-2020.com).mp3 | 2022-08-12 11:02 | 0 | |
![[SND]](/icons/sound2.gif) | Myz1.mp3 | 2022-08-12 10:58 | 0 | |
![[SND]](/icons/sound2.gif) | selebew.mp3 | 2022-08-12 10:57 | 0 | |
![[SND]](/icons/sound2.gif) | Zexx1.mp3 | 2022-08-12 10:54 | 0 | |
![[SND]](/icons/sound2.gif) | M.I.B - Jak (Official MV).mp3 | 2022-08-12 10:54 | 0 | |
![[SND]](/icons/sound2.gif) | Marshi I UÇK (Albanian War Song).mp3 | 2022-08-12 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | omda1.mp3 | 2022-08-12 10:47 | 0 | |
![[SND]](/icons/sound2.gif) | instasamka-moneyken-love-speed-up.mp3 | 2022-08-12 10:45 | 0 | |
![[SND]](/icons/sound2.gif) | King of Doowhite - Maiyarap ft.Repaze [Official MV].mp3 | 2022-08-12 10:44 | 0 | |
![[SND]](/icons/sound2.gif) | sova-pesni-staryh-kasset.mp3 | 2022-08-12 10:42 | 0 | |
![[SND]](/icons/sound2.gif) | chillbuon1199.mp3 | 2022-08-12 10:41 | 0 | |
![[SND]](/icons/sound2.gif) | VY.mp3 | 2022-08-12 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Баллада о забытом мире.mp3 | 2022-08-12 10:39 | 212K | |
![[SND]](/icons/sound2.gif) | white_NH4XfTU.mp3 | 2022-08-12 10:37 | 0 | |
![[SND]](/icons/sound2.gif) | not-for-sale-fossil-kanon-wakeshima-4786337666483773616-dgtx5sbw_0whlYJAI.mp3 | 2022-08-12 10:36 | 0 | |
![[SND]](/icons/sound2.gif) | not-for-sale-fossil-kanon-wakeshima-4786337666483773616-dgtx5sbw_0Njc72gq.mp3 | 2022-08-12 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | nhacthattinh1129.mp3 | 2022-08-12 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | ajimat.mp3 | 2022-08-12 10:35 | 916K | |
![[SND]](/icons/sound2.gif) | chpunk-edison-ochko.mp3 | 2022-08-12 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | belat1109.mp3 | 2022-08-12 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | not-for-sale-fossil-kanon-wakeshima-4786337666483773616_DGtX5sbw.mp3 | 2022-08-12 10:27 | 0 | |
![[SND]](/icons/sound2.gif) | pesnya-ya-mazhu-vazelinom.mp3 | 2022-08-12 10:21 | 0 | |
![[SND]](/icons/sound2.gif) | dajte-tank-besy_(mp3IQ.net).mp3 | 2022-08-12 10:18 | 0 | |
![[SND]](/icons/sound2.gif) | alpin.mp3 | 2022-08-12 10:16 | 0 | |
![[SND]](/icons/sound2.gif) | k111.mp3 | 2022-08-12 10:15 | 0 | |
![[SND]](/icons/sound2.gif) | They.mp3 | 2022-08-12 10:13 | 0 | |
![[SND]](/icons/sound2.gif) | Аквариум - 212-85-06 (OST ПитерFM).mp3 | 2022-08-12 10:11 | 6.5M | |
![[SND]](/icons/sound2.gif) | Dajjte_tank_-_Besy_(musmore.com).mp3 | 2022-08-12 10:11 | 0 | |
![[SND]](/icons/sound2.gif) | zxcursedkillua.mp3.mp3 | 2022-08-12 10:10 | 0 | |
![[SND]](/icons/sound2.gif) | s99.mp3 | 2022-08-12 10:10 | 0 | |
![[SND]](/icons/sound2.gif) | darr1.mp3 | 2022-08-12 10:09 | 0 | |
![[SND]](/icons/sound2.gif) | rexx.mp3 | 2022-08-12 10:09 | 0 | |
![[SND]](/icons/sound2.gif) | zxcursedKillua (2).mp3 | 2022-08-12 10:06 | 0 | |
![[SND]](/icons/sound2.gif) | zxcursedkillua.mp3 | 2022-08-12 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | dar1.mp3 | 2022-08-12 10:04 | 0 | |
![[SND]](/icons/sound2.gif) | audiomsg_641244583.mp3 | 2022-08-12 10:04 | 0 | |
![[SND]](/icons/sound2.gif) | imagelinefixyourshittyprogram.mp3 | 2022-08-12 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | DANY8081.mp3 | 2022-08-12 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | darar1.mp3 | 2022-08-12 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | The.mp3 | 2022-08-12 09:59 | 104K | |
![[SND]](/icons/sound2.gif) | Falmengkane11.mp3 | 2022-08-12 09:59 | 0 | |
![[SND]](/icons/sound2.gif) | yahah.mp3 | 2022-08-12 09:55 | 0 | |
![[SND]](/icons/sound2.gif) | CALLME.mp3 | 2022-08-12 09:53 | 0 | |
![[SND]](/icons/sound2.gif) | The Yes Yes Show - Francis M & Parokya Ni Edgar.mp3 | 2022-08-12 09:52 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ KANDAS DANGDUT DJ KANDAS JEDAG JEDUG SLOW FULL BASS VIRAL FYP TIK TOK 2022.mp3 | 2022-08-12 09:51 | 0 | |
![[SND]](/icons/sound2.gif) | GREYGODS[ConverteZilla.com].mp3 | 2022-08-12 09:51 | 0 | |
![[SND]](/icons/sound2.gif) | zxcursed_Killua.mp3 | 2022-08-12 09:51 | 0 | |
![[SND]](/icons/sound2.gif) | sunroof.mp3 | 2022-08-12 09:50 | 2.7M | |
![[SND]](/icons/sound2.gif) | k6.mp3 | 2022-08-12 09:49 | 1.9M | |
![[SND]](/icons/sound2.gif) | k5.mp3 | 2022-08-12 09:48 | 7.7M | |
![[SND]](/icons/sound2.gif) | zxcursed_-_killua_74293338.mp3 | 2022-08-12 09:45 | 0 | |
![[SND]](/icons/sound2.gif) | GARUDA.mp3 | 2022-08-12 09:43 | 0 | |
![[SND]](/icons/sound2.gif) | Klava_Bravo_Nazyvaj_menya_trener_remiks.mp3 | 2022-08-12 09:42 | 2.1M | |
![[SND]](/icons/sound2.gif) | k3.mp3 | 2022-08-12 09:41 | 3.1M | |
![[SND]](/icons/sound2.gif) | fridaynight.mp3 | 2022-08-12 09:38 | 3.2M | |
![[SND]](/icons/sound2.gif) | Djenak.mp3 | 2022-08-12 09:36 | 4.0M | |
![[SND]](/icons/sound2.gif) | Oliver_Tree_-_Jerk_70287833.mp3 | 2022-08-12 09:34 | 2.3M | |
![[SND]](/icons/sound2.gif) | XD5.mp3 | 2022-08-12 09:33 | 0 | |
![[SND]](/icons/sound2.gif) | shadowraze_-_Shadow_Fiend_73331416.mp3 | 2022-08-12 09:33 | 0 | |
![[SND]](/icons/sound2.gif) | shadowfiend_feat_perfect_player_-_shadowraze_71630335.mp3 | 2022-08-12 09:33 | 0 | |
![[SND]](/icons/sound2.gif) | joy100.mp3 | 2022-08-12 09:32 | 0 | |
![[SND]](/icons/sound2.gif) | XD4.mp3 | 2022-08-12 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | shadowraze_-_juggernaut_Prod_by_PLVSTIC_Prod_by_PLVSTIC_73220345.mp3 | 2022-08-12 09:26 | 0 | |
![[SND]](/icons/sound2.gif) | rakhim_20_-_21.mp3 | 2022-08-12 09:26 | 0 | |
![[SND]](/icons/sound2.gif) | Shadowraze_babyswishh1_-_psiblades_73220334 (1).mp3 | 2022-08-12 09:26 | 0 | |
![[SND]](/icons/sound2.gif) | ebanko-lyubitel-sobak-ya-ebu-sobak.mp3 | 2022-08-12 09:25 | 5.1M | |
![[SND]](/icons/sound2.gif) | XD3.mp3 | 2022-08-12 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | XD2.mp3 | 2022-08-12 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | XD6.mp3 | 2022-08-12 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | rakhim_20-21.mp3 | 2022-08-12 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | zxcursed_-_never_enough_74046259.mp3 | 2022-08-12 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | XD1.mp3 | 2022-08-12 09:21 | 0 | |
![[SND]](/icons/sound2.gif) | nelsen.mp3 | 2022-08-12 09:14 | 0 | |
![[SND]](/icons/sound2.gif) | rakhim_20-20.mp3 | 2022-08-12 09:06 | 5.2M | |
![[SND]](/icons/sound2.gif) | mikedingin.mp3 | 2022-08-12 09:03 | 4.5M | |
![[SND]](/icons/sound2.gif) | BAKAR.mp3 | 2022-08-12 09:03 | 4.2M | |
![[SND]](/icons/sound2.gif) | ER.mp3 | 2022-08-12 09:02 | 3.6M | |
![[SND]](/icons/sound2.gif) | rakhim_20_20.mp3 | 2022-08-12 09:01 | 0 | |
![[SND]](/icons/sound2.gif) | mike2.mp3 | 2022-08-12 08:57 | 0 | |
![[SND]](/icons/sound2.gif) | xvx.mp3 | 2022-08-12 08:54 | 0 | |
![[SND]](/icons/sound2.gif) | sepka.mp3 | 2022-08-12 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | shen.mp3 | 2022-08-12 08:45 | 0 | |
![[SND]](/icons/sound2.gif) | Dhije4.mp3 | 2022-08-12 08:45 | 3.3M | |
![[SND]](/icons/sound2.gif) | xa.mp3 | 2022-08-12 08:44 | 3.8M | |
![[SND]](/icons/sound2.gif) | tothebone.mp3 | 2022-08-12 08:42 | 2.0M | |
![[SND]](/icons/sound2.gif) | beautyandbeat.mp3 | 2022-08-12 08:38 | 0 | |
![[SND]](/icons/sound2.gif) | Xybca5.mp3 | 2022-08-12 08:37 | 0 | |
![[SND]](/icons/sound2.gif) | Sektor_Gaza_-_Kolkhoznyjj_pank_48646528.mp3 | 2022-08-12 08:33 | 0 | |
![[SND]](/icons/sound2.gif) | cigar.mp3 | 2022-08-12 08:30 | 0 | |
![[SND]](/icons/sound2.gif) | Sergejj_Zavyalov_-_Ty_dlya_menya_odna_62331592.mp3 | 2022-08-12 08:30 | 0 | |
![[SND]](/icons/sound2.gif) | tiktod.mp3 | 2022-08-12 08:28 | 0 | |
![[SND]](/icons/sound2.gif) | BOJO.mp3 | 2022-08-12 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | ANJ.mp3 | 2022-08-12 08:20 | 0 | |
![[SND]](/icons/sound2.gif) | SOUND JJ ZERSOFBOY.mp3 | 2022-08-12 08:19 | 0 | |
![[SND]](/icons/sound2.gif) | anditox.mp3 | 2022-08-12 08:17 | 0 | |
![[SND]](/icons/sound2.gif) | vv.mp3 | 2022-08-12 08:16 | 200K | |
![[SND]](/icons/sound2.gif) | Cardi_B_Megan_Thee_Stallion_-_WAP_70519836.mp3 | 2022-08-12 08:16 | 0 | |
![[SND]](/icons/sound2.gif) | BOBOLE.mp3 | 2022-08-12 08:16 | 0 | |
![[SND]](/icons/sound2.gif) | casablanca.mp3 | 2022-08-12 08:15 | 256K | |
![[SND]](/icons/sound2.gif) | luce4.mp3 | 2022-08-12 08:14 | 0 | |
![[SND]](/icons/sound2.gif) | gehoy.mp3 | 2022-08-12 08:11 | 0 | |
![[SND]](/icons/sound2.gif) | ww.mp3 | 2022-08-12 08:11 | 2.8M | |
![[SND]](/icons/sound2.gif) | ayana.mp3 | 2022-08-12 08:09 | 0 | |
![[SND]](/icons/sound2.gif) | comeonradio.mp3 | 2022-08-12 08:07 | 0 | |
![[SND]](/icons/sound2.gif) | SnapTik_7051841172783910170.mp3 | 2022-08-12 08:06 | 0 | |
![[SND]](/icons/sound2.gif) | Mobb Deep - Shook Ones, Pt. II (Official HD Video).mp3 | 2022-08-12 08:05 | 0 | |
![[SND]](/icons/sound2.gif) | ComeInside3.mp3 | 2022-08-12 08:03 | 0 | |
![[SND]](/icons/sound2.gif) | OOR3.mp3 | 2022-08-12 08:02 | 1.8M | |
![[SND]](/icons/sound2.gif) | Decade1.mp3 | 2022-08-12 07:58 | 0 | |
![[SND]](/icons/sound2.gif) | DJBABA.mp3 | 2022-08-12 07:57 | 0 | |
![[SND]](/icons/sound2.gif) | A05.mp3 | 2022-08-12 07:56 | 0 | |
![[SND]](/icons/sound2.gif) | A04.mp3 | 2022-08-12 07:56 | 0 | |
![[SND]](/icons/sound2.gif) | A03.mp3 | 2022-08-12 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | A02.mp3 | 2022-08-12 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | A01.mp3 | 2022-08-12 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | Yang Peng - Long Night Journey.mp3 | 2022-08-12 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | Just Friends - Pee Wee Gaskins Instrument (minus one karoke version, no vocal) lyric.mp3 | 2022-08-12 07:54 | 0 | |
![[SND]](/icons/sound2.gif) | OOR2.mp3 | 2022-08-12 07:53 | 0 | |
![[SND]](/icons/sound2.gif) | Vp12.mp3 | 2022-08-12 07:49 | 3.5M | |
![[SND]](/icons/sound2.gif) | Vp11.mp3 | 2022-08-12 07:49 | 3.7M | |
![[SND]](/icons/sound2.gif) | Aarne feat. Big Baby Tape - Ski Ski (2).mp3 | 2022-08-12 07:46 | 0 | |
![[SND]](/icons/sound2.gif) | RdP12.mp3 | 2022-08-12 07:44 | 0 | |
![[SND]](/icons/sound2.gif) | TULUS-Monokrom-Official-Music-Video_QqJ-Vp8mvbk.mp3 | 2022-08-12 07:43 | 0 | |
![[SND]](/icons/sound2.gif) | Decade9.mp3 | 2022-08-12 07:40 | 0 | |
![[SND]](/icons/sound2.gif) | fivem3.mp3 | 2022-08-12 07:36 | 0 | |
![[SND]](/icons/sound2.gif) | OOR1.mp3 | 2022-08-12 07:36 | 0 | |
![[SND]](/icons/sound2.gif) | Sugaldo Ganteng.mp3 | 2022-08-12 07:36 | 0 | |
![[SND]](/icons/sound2.gif) | luce2.mp3 | 2022-08-12 07:33 | 0 | |
![[SND]](/icons/sound2.gif) | on.mp3 | 2022-08-12 07:32 | 2.4M | |
![[SND]](/icons/sound2.gif) | ALX.mp3 | 2022-08-12 07:27 | 0 | |
![[SND]](/icons/sound2.gif) | Zv1.mp3 | 2022-08-12 07:26 | 0 | |
![[SND]](/icons/sound2.gif) | bp-du2.mp3 | 2022-08-12 07:25 | 0 | |
![[SND]](/icons/sound2.gif) | bp-du.mp3 | 2022-08-12 07:22 | 0 | |
![[SND]](/icons/sound2.gif) | shadowraze.mp3 | 2022-08-12 07:22 | 4.6M | |
![[SND]](/icons/sound2.gif) | rc.mp3 | 2022-08-12 07:17 | 0 | |
![[SND]](/icons/sound2.gif) | Modern Talking — Cheri Cheri Lady.mp3 | 2022-08-12 07:17 | 0 | |
![[SND]](/icons/sound2.gif) | Мурат Тхагалегов - За тебя Калым отдам.mp3 | 2022-08-12 07:17 | 208K | |
![[SND]](/icons/sound2.gif) | Binibirocha.mp3 | 2022-08-12 07:14 | 3.2M | |
![[SND]](/icons/sound2.gif) | INSTASAMKA – MONEYKEN LOVE prod realmoneyken.mp3 | 2022-08-12 07:13 | 0 | |
![[SND]](/icons/sound2.gif) | RV.mp3 | 2022-08-12 07:10 | 0 | |
![[SND]](/icons/sound2.gif) | rv-fmr1.mp3 | 2022-08-12 07:06 | 0 | |
![[SND]](/icons/sound2.gif) | MESSII.mp3 | 2022-08-12 07:03 | 0 | |
![[SND]](/icons/sound2.gif) | rv-fmr.mp3 | 2022-08-12 06:58 | 0 | |
![[SND]](/icons/sound2.gif) | dr-dre-deep-cover-feat-snoop-dogg.mp3 | 2022-08-12 06:55 | 9.8M | |
![[VID]](/icons/movie.gif) | Tan2.mp4 | 2022-08-12 06:55 | 0 | |
![[SND]](/icons/sound2.gif) | Freddie Dredd - All Alone.mp3 | 2022-08-12 06:55 | 0 | |
![[SND]](/icons/sound2.gif) | snoop-dogg-dr-dre-deep-cover-uncensored.mp3 | 2022-08-12 06:54 | 0 | |
![[SND]](/icons/sound2.gif) | Dr. Dre - Deep Cover (feat. Snoop Dogg) (mp3store.cc).mp3 | 2022-08-12 06:53 | 0 | |
![[SND]](/icons/sound2.gif) | instasamka-moya-kiska-dlya-nego-vsegda-gotova.mp3 | 2022-08-12 06:53 | 0 | |
![[SND]](/icons/sound2.gif) | Psych - 9 Мая [Рэп-Столица]_(tiktok-pesni.com).mp3 | 2022-08-12 06:50 | 0 | |
![[VID]](/icons/movie.gif) | tan.mp4 | 2022-08-12 06:47 | 408K | |
![[SND]](/icons/sound2.gif) | aespa-lts.mp3 | 2022-08-12 06:45 | 2.9M | |
![[SND]](/icons/sound2.gif) | BORNEO.mp3 | 2022-08-12 06:43 | 8.0M | |
![[SND]](/icons/sound2.gif) | ikmal.mp3 | 2022-08-12 06:39 | 278K | |
![[SND]](/icons/sound2.gif) | hejoboys.mp3 | 2022-08-12 06:36 | 0 | |
![[SND]](/icons/sound2.gif) | N3.mp3 | 2022-08-12 06:35 | 0 | |
![[SND]](/icons/sound2.gif) | N2.mp3 | 2022-08-12 06:34 | 0 | |
![[SND]](/icons/sound2.gif) | akamsi.mp3 | 2022-08-12 06:32 | 0 | |
![[SND]](/icons/sound2.gif) | N1.mp3 | 2022-08-12 06:32 | 0 | |
![[SND]](/icons/sound2.gif) | あれくん Alekun「ずるいよ、、、」Zurui yo _Lyrics.mp3 | 2022-08-12 06:24 | 0 | |
![[SND]](/icons/sound2.gif) | #Lyric WEST MELANESIA.mp3 | 2022-08-12 06:23 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - GUYONWATON OFFICIAL SEBATAS TEMAN OFFICIAL LYRIC VIDEO.mp3 | 2022-08-12 06:23 | 0 | |
![[SND]](/icons/sound2.gif) | sound.mp3 | 2022-08-12 06:21 | 0 | |
![[SND]](/icons/sound2.gif) | jah-khalib-guf-na-svoyom-vajbe-mp3.mp3 | 2022-08-12 06:18 | 0 | |
![[SND]](/icons/sound2.gif) | Jah Khalib _ Guf - На Своём Vibe.mp3 | 2022-08-12 06:17 | 0 | |
![[SND]](/icons/sound2.gif) | Mario Zwinkle X Keilandboi - Heavy In The Game INSTRUMENTAL.mp3 | 2022-08-12 06:17 | 0 | |
![[SND]](/icons/sound2.gif) | Пошлая Молли - Нон стоп.mp3 | 2022-08-12 06:16 | 0 | |
![[SND]](/icons/sound2.gif) | bagiduo.mp3 | 2022-08-12 06:07 | 4.3M | |
![[SND]](/icons/sound2.gif) | gtw.mp3 | 2022-08-12 05:58 | 0 | |
![[SND]](/icons/sound2.gif) | Dj.mp3 | 2022-08-12 05:56 | 0 | |
![[SND]](/icons/sound2.gif) | nicaplaylist.mp3 | 2022-08-12 05:52 | 0 | |
![[SND]](/icons/sound2.gif) | mabukcinta.mp3 | 2022-08-12 05:50 | 0 | |
![[SND]](/icons/sound2.gif) | SANS.mp3 | 2022-08-12 05:50 | 0 | |
![[SND]](/icons/sound2.gif) | Ezra7.mp3 | 2022-08-12 05:49 | 0 | |
![[SND]](/icons/sound2.gif) | SKIN.mp3 | 2022-08-12 05:48 | 0 | |
![[SND]](/icons/sound2.gif) | LL.mp3 | 2022-08-12 05:46 | 2.8M | |
![[SND]](/icons/sound2.gif) | Wolve.mp3 | 2022-08-12 05:46 | 0 | |
![[SND]](/icons/sound2.gif) | Честный - Мама.mp3 | 2022-08-12 05:45 | 0 | |
![[SND]](/icons/sound2.gif) | Glooco2.mp3 | 2022-08-12 05:42 | 1.6M | |
![[SND]](/icons/sound2.gif) | Glooco1.mp3 | 2022-08-12 05:41 | 467K | |
![[SND]](/icons/sound2.gif) | mp15.mp3 | 2022-08-12 05:41 | 3.6M | |
![[SND]](/icons/sound2.gif) | DhikaSad.mp3 | 2022-08-12 05:40 | 0 | |
![[SND]](/icons/sound2.gif) | mp14.mp3 | 2022-08-12 05:38 | 268K | |
![[SND]](/icons/sound2.gif) | DEYO.mp3 | 2022-08-12 05:38 | 184K | |
![[SND]](/icons/sound2.gif) | kkk.mp3 | 2022-08-12 05:37 | 2.2M | |
![[SND]](/icons/sound2.gif) | plume.mp3 | 2022-08-12 05:36 | 0 | |
![[SND]](/icons/sound2.gif) | XNCX.mp3 | 2022-08-12 05:33 | 52K | |
![[SND]](/icons/sound2.gif) | mp13.mp3 | 2022-08-12 05:32 | 4.2M | |
![[SND]](/icons/sound2.gif) | aaa.mp3 | 2022-08-12 05:29 | 2.0M | |
![[SND]](/icons/sound2.gif) | plenka_-_Call_Me_(Slowed).mp3 | 2022-08-12 05:28 | 6.2M | |
![[SND]](/icons/sound2.gif) | prodby668_-_prolly_my_spookiest_beat_sped_up_73964471.mp3 | 2022-08-12 05:27 | 0 | |
![[SND]](/icons/sound2.gif) | Lemon_Demon_-_Touch-Tone_Telephone_69649037.mp3 | 2022-08-12 05:26 | 0 | |
![[SND]](/icons/sound2.gif) | WESTLBRTY'S - SAN-FIERRO.mp3 | 2022-08-12 05:26 | 0 | |
![[SND]](/icons/sound2.gif) | sss.mp3 | 2022-08-12 05:18 | 3.0M | |
![[SND]](/icons/sound2.gif) | friendcity1.mp3 | 2022-08-12 05:18 | 0 | |
![[SND]](/icons/sound2.gif) | pasoori.mp3 | 2022-08-12 05:15 | 3.6M | |
![[SND]](/icons/sound2.gif) | friends1.mp3 | 2022-08-12 05:15 | 0 | |
![[SND]](/icons/sound2.gif) | friends2.mp3 | 2022-08-12 05:14 | 0 | |
![[SND]](/icons/sound2.gif) | Norin.mp3 | 2022-08-12 05:14 | 880K | |
![[SND]](/icons/sound2.gif) | friend1.mp3 | 2022-08-12 05:11 | 0 | |
![[SND]](/icons/sound2.gif) | frend1.mp3 | 2022-08-12 05:09 | 0 | |
![[SND]](/icons/sound2.gif) | da.mp3 | 2022-08-12 05:07 | 3.1M | |
![[SND]](/icons/sound2.gif) | aku selalu bahagia.mp3 | 2022-08-12 05:06 | 0 | |
![[SND]](/icons/sound2.gif) | หูไม่ตรงกับตา.mp3 | 2022-08-12 05:06 | 0 | |
![[SND]](/icons/sound2.gif) | WE_NEVER_DIE_-_BROKER_NEIRP_ANTHEM_OFFICIAL_AUDIO_(Prod.By_Rifky_Arizaldy)(128k).mp3 | 2022-08-12 05:04 | 3.0M | |
![[SND]](/icons/sound2.gif) | ck.mp3 | 2022-08-12 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | friend-1.mp3 | 2022-08-12 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | 4WHEEL_-_KERAUNOS_KILLER_73336472.mp3 | 2022-08-12 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | กำลังฮิตในTikTok ( เอวติดไฟ -Bear Knuckle) V.แดนซ์ยกเบสหนัก ๆๆ Pao Remix.mp3 | 2022-08-12 05:00 | 0 | |
![[SND]](/icons/sound2.gif) | Psyco M - Plume-Psyco-M.mp3 | 2022-08-12 04:44 | 0 | |
![[SND]](/icons/sound2.gif) | Party.mp3 | 2022-08-12 04:35 | 0 | |
![[SND]](/icons/sound2.gif) | Journey_-_Separate_Ways_Worlds_Apa_(getmp3.pro).mp3 | 2022-08-12 04:31 | 0 | |
![[SND]](/icons/sound2.gif) | Endank.mp3 | 2022-08-12 04:27 | 0 | |
![[SND]](/icons/sound2.gif) | Bungul3.mp3 | 2022-08-12 04:27 | 0 | |
![[SND]](/icons/sound2.gif) | Bungul4.mp3 | 2022-08-12 04:27 | 0 | |
![[SND]](/icons/sound2.gif) | who.mp3 | 2022-08-12 04:22 | 0 | |
![[SND]](/icons/sound2.gif) | bck.mp3 | 2022-08-12 04:22 | 0 | |
![[SND]](/icons/sound2.gif) | CL.mp3 | 2022-08-12 04:17 | 0 | |
![[SND]](/icons/sound2.gif) | milisikecoa.mp3 | 2022-08-12 04:12 | 0 | |
![[SND]](/icons/sound2.gif) | PERFECTCHRISTMAS.mp3 | 2022-08-12 04:04 | 0 | |
![[SND]](/icons/sound2.gif) | nhelongvlc.mp3 | 2022-08-12 03:57 | 2.5M | |
![[SND]](/icons/sound2.gif) | tklove.mp3 | 2022-08-12 03:33 | 0 | |
![[SND]](/icons/sound2.gif) | 徐佳莹&阿爆&Brandy-切歌 feat. ABAO阿爆&Brandy.mp3 | 2022-08-12 03:32 | 0 | |
![[SND]](/icons/sound2.gif) | Azari_-_Nightmare_(musmore.com).mp3 | 2022-08-12 03:28 | 0 | |
![[SND]](/icons/sound2.gif) | hot60.mp3 | 2022-08-12 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ TELOLET X RINDU SEMALAM SLOW Viral Di Fyp TikTok.mp3 | 2022-08-12 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | rap100.mp3 | 2022-08-12 03:14 | 0 | |
![[SND]](/icons/sound2.gif) | p2.mp3 | 2022-08-12 03:10 | 536K | |
![[SND]](/icons/sound2.gif) | bangbang.mp3 | 2022-08-12 03:06 | 0 | |
![[SND]](/icons/sound2.gif) | (26,29,35,40hz)Need for Speed - Get Low(Screwed by Gorilla_Bass).mp3 | 2022-08-12 03:04 | 0 | |
![[SND]](/icons/sound2.gif) | Dissah Dzu - Uatnek 21.mp3 | 2022-08-12 02:58 | 0 | |
![[SND]](/icons/sound2.gif) | BODIEV - Между девятин.mp3 | 2022-08-12 02:58 | 0 | |
![[SND]](/icons/sound2.gif) | 77-й'. - .mp3 | 2022-08-12 02:58 | 0 | |
![[SND]](/icons/sound2.gif) | 1-❤ - качает`.mp3 | 2022-08-12 02:58 | 2.0M | |
![[SND]](/icons/sound2.gif) | p1.mp3 | 2022-08-12 02:47 | 214K | |
![[SND]](/icons/sound2.gif) | Ben3.mp3 | 2022-08-12 02:36 | 0 | |
![[SND]](/icons/sound2.gif) | WestBarrio.mp3 | 2022-08-12 02:29 | 0 | |
![[SND]](/icons/sound2.gif) | Takbo.mp3 | 2022-08-12 02:29 | 0 | |
![[SND]](/icons/sound2.gif) | BCFL.mp3 | 2022-08-12 02:29 | 0 | |
![[SND]](/icons/sound2.gif) | RidinHigh.mp3 | 2022-08-12 02:29 | 0 | |
![[SND]](/icons/sound2.gif) | Pagmamahal.mp3 | 2022-08-12 02:28 | 0 | |
![[SND]](/icons/sound2.gif) | OneOfTheseDays.mp3 | 2022-08-12 02:28 | 0 | |
![[SND]](/icons/sound2.gif) | bang3.mp3 | 2022-08-12 02:24 | 0 | |
![[SND]](/icons/sound2.gif) | andika1.mp3 | 2022-08-12 02:09 | 0 | |
![[SND]](/icons/sound2.gif) | AjimatMG.mp3 | 2022-08-12 02:08 | 0 | |
![[SND]](/icons/sound2.gif) | hatepok1.mp3 | 2022-08-12 02:08 | 0 | |
![[SND]](/icons/sound2.gif) | SAY.mp3 | 2022-08-12 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | How.mp3 | 2022-08-12 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | NOTHING.mp3 | 2022-08-12 02:07 | 3.8M | |
![[SND]](/icons/sound2.gif) | Never.mp3 | 2022-08-12 02:07 | 3.2M | |
![[SND]](/icons/sound2.gif) | FOREVER.mp3 | 2022-08-12 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | Thewill.mp3 | 2022-08-12 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | EXCHANGE.mp3 | 2022-08-12 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | KLM.mp3 | 2022-08-12 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | andika1.m4a | 2022-08-12 02:02 | 0 | |
![[SND]](/icons/sound2.gif) | Jewish Princess.mp3 | 2022-08-12 02:00 | 0 | |
![[SND]](/icons/sound2.gif) | xwan39.mp3 | 2022-08-12 01:59 | 0 | |
![[SND]](/icons/sound2.gif) | xwan40.mp3 | 2022-08-12 01:58 | 0 | |
![[SND]](/icons/sound2.gif) | xwan41.mp3 | 2022-08-12 01:58 | 0 | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - Round Change - Shadows of Evil - Soundtrack-OGYa9IrOf9s-160k-1660269164390.mp3 | 2022-08-12 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | np6.mp3 | 2022-08-12 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | np5.mp3 | 2022-08-12 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | np4.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | np3.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | Pagsamo.mp3 | 2022-08-12 01:53 | 4.4M | |
![[SND]](/icons/sound2.gif) | Say.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | Mapa.mp3 | 2022-08-12 01:53 | 2.2M | |
![[SND]](/icons/sound2.gif) | NOBITA.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | the will.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | Binibini.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | np2.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | Exchange.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | np1.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | tarik1.mp3 | 2022-08-12 01:52 | 3.3M | |
![[SND]](/icons/sound2.gif) | M.T.G - (Only Fans feat. No1-NOAH .mp3 | 2022-08-12 01:51 | 0 | |
![[SND]](/icons/sound2.gif) | Forevermore.mp3 | 2022-08-12 01:47 | 812K | |
![[SND]](/icons/sound2.gif) | TheFinal.mp3 | 2022-08-12 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | bv.mp3 | 2022-08-12 01:37 | 0 | |
![[SND]](/icons/sound2.gif) | Vendredi13Août2021.mp3 | 2022-08-12 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | Dw1.mp3 | 2022-08-12 01:26 | 80K | |
![[SND]](/icons/sound2.gif) | Dw3.mp3 | 2022-08-12 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | Dw2.mp3 | 2022-08-12 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | Dw5.mp3 | 2022-08-12 01:26 | 1.6M | |
![[SND]](/icons/sound2.gif) | lagu1.mp3 | 2022-08-12 01:24 | 1.1M | |
![[SND]](/icons/sound2.gif) | Afgan - Jodoh Pasti Bertemu Official Video Clip.mp3 | 2022-08-12 01:23 | 0 | |
![[SND]](/icons/sound2.gif) | On The Floor - Jennifer Lopez.mp3 | 2022-08-12 01:22 | 5.7M | |
![[SND]](/icons/sound2.gif) | Kesariya (From Brahmastra) - Pritam.mp3 | 2022-08-12 01:22 | 4.1M | |
![[SND]](/icons/sound2.gif) | Hookah Bar (LoFi) - Shubham Rangra.mp3 | 2022-08-12 01:22 | 4.4M | |
![[SND]](/icons/sound2.gif) | Sodakku_From_Thaanaa_Serndha_Koottam_Anirudh_Ravichander.mp3 | 2022-08-12 01:22 | 3.7M | |
![[SND]](/icons/sound2.gif) | Azhalinte_Azhangalil_From_Ayalum_Njanum_Thammil_Male_Vocals_Nikhil.mp3 | 2022-08-12 01:22 | 5.2M | |
![[SND]](/icons/sound2.gif) | Kudukku - Vineeth Sreenivasan.mp3 | 2022-08-12 01:21 | 2.4M | |
![[SND]](/icons/sound2.gif) | mn.mp3 | 2022-08-12 01:21 | 2.4M | |
![[SND]](/icons/sound2.gif) | Project - 8:11:22, 5.59 PM.mp3 | 2022-08-12 01:20 | 0 | |
![[SND]](/icons/sound2.gif) | v4.mp3 | 2022-08-12 01:19 | 3.4M | |
![[SND]](/icons/sound2.gif) | Vicks1.mp3 | 2022-08-12 01:18 | 1.3M | |
![[SND]](/icons/sound2.gif) | v5.mp3 | 2022-08-12 01:15 | 388K | |
![[SND]](/icons/sound2.gif) | Jejennie.mp3 | 2022-08-12 01:14 | 0 | |
![[SND]](/icons/sound2.gif) | vp7.mp3 | 2022-08-12 01:12 | 0 | |
![[SND]](/icons/sound2.gif) | mygang.mp3 | 2022-08-12 01:11 | 0 | |
![[SND]](/icons/sound2.gif) | 1_4943094942051336640.mp3 | 2022-08-12 01:09 | 0 | |
![[SND]](/icons/sound2.gif) | Took Him Too - John Sebby Elliott Sheridan.mp3 | 2022-08-12 01:08 | 0 | |
![[SND]](/icons/sound2.gif) | matila.mp3 | 2022-08-12 01:06 | 0 | |
![[SND]](/icons/sound2.gif) | Razz1.mp3 | 2022-08-12 01:05 | 0 | |
![[SND]](/icons/sound2.gif) | phupu.mp3 | 2022-08-12 01:03 | 0 | |
![[SND]](/icons/sound2.gif) | 7077114216255064859.mp3 | 2022-08-12 00:59 | 0 | |
![[SND]](/icons/sound2.gif) | N1NT3ND0_-_CHP_47965410.mp3 | 2022-08-12 00:55 | 0 | |
![[SND]](/icons/sound2.gif) | puresouls7.22.19.mp3 | 2022-08-12 00:50 | 0 | |
![[SND]](/icons/sound2.gif) | LILDRUGHILL_MARCO_9_Jet.mp3 | 2022-08-12 00:42 | 0 | |
![[SND]](/icons/sound2.gif) | rastaman-ne-nuzhna-mne-korona-princessa-i-gory.mp3 | 2022-08-12 00:36 | 0 | |
![[SND]](/icons/sound2.gif) | N1NT3ND0 - ЧП.mp3 | 2022-08-12 00:36 | 0 | |
![[SND]](/icons/sound2.gif) | LILDRUGHILL_ROCKET_Terminal.mp3 | 2022-08-12 00:35 | 0 | |
![[SND]](/icons/sound2.gif) | Jennie1945.mp3 | 2022-08-12 00:32 | 0 | |
![[SND]](/icons/sound2.gif) | Rin Ljubav for life.mp3 | 2022-08-12 00:27 | 0 | |
![[SND]](/icons/sound2.gif) | Brayen2.mp3 | 2022-08-12 00:17 | 0 | |
![[SND]](/icons/sound2.gif) | Brayen3.mp3 | 2022-08-12 00:17 | 0 | |
![[SND]](/icons/sound2.gif) | Brayen5.mp3 | 2022-08-12 00:17 | 0 | |
![[SND]](/icons/sound2.gif) | pu.mp3 | 2022-08-12 00:16 | 0 | |
![[SND]](/icons/sound2.gif) | Brayen4.mp3 | 2022-08-12 00:15 | 0 | |
![[SND]](/icons/sound2.gif) | Brayen1.mp3 | 2022-08-12 00:13 | 0 | |
![[SND]](/icons/sound2.gif) | Ytta1.mp3 | 2022-08-12 00:11 | 0 | |
![[SND]](/icons/sound2.gif) | Ytta40.mp3 | 2022-08-12 00:08 | 0 | |
![[SND]](/icons/sound2.gif) | Phu.mp3 | 2022-08-12 00:08 | 2.5M | |
![[SND]](/icons/sound2.gif) | Gnjr.mp3 | 2022-08-12 00:06 | 2.4M | |
![[SND]](/icons/sound2.gif) | Sbbg.mp3 | 2022-08-12 00:05 | 0 | |
![[SND]](/icons/sound2.gif) | Gnjrrmx.mp3 | 2022-08-12 00:05 | 0 | |
![[SND]](/icons/sound2.gif) | Abubudu.mp3 | 2022-08-11 23:54 | 0 | |
![[SND]](/icons/sound2.gif) | DIBANDINGKE.mp3 | 2022-08-11 23:53 | 3.0M | |
![[SND]](/icons/sound2.gif) | JENNIENATAEL90.mp3 | 2022-08-11 23:47 | 4.5M | |
![[SND]](/icons/sound2.gif) | mood.mp3 | 2022-08-11 23:46 | 2.1M | |
![[SND]](/icons/sound2.gif) | ChippedAx.mp3 | 2022-08-11 23:44 | 0 | |
![[SND]](/icons/sound2.gif) | Chipped Ax - Lion Numchok and Joke So Cool (Official MV)(MP3_320K).mp3 | 2022-08-11 23:41 | 0 | |
![[SND]](/icons/sound2.gif) | Sabilulungan Trap.mp3 | 2022-08-11 23:32 | 0 | |
![[SND]](/icons/sound2.gif) | Genjer Genjer (1).mp3 | 2022-08-11 23:30 | 0 | |
![[SND]](/icons/sound2.gif) | genjer genjer remix .mp3 | 2022-08-11 23:30 | 0 | |
![[SND]](/icons/sound2.gif) | MAZ_KORZH_-_negry_vse_pidorasy_(iPleer.com).mp3 | 2022-08-11 23:21 | 0 | |
![[SND]](/icons/sound2.gif) | zawanbeats-low.mp3 | 2022-08-11 23:12 | 0 | |
![[SND]](/icons/sound2.gif) | DVRST_6YNTHMANE_ANTICXLTXRE_-_Will_Be_Soon_74627715.mp3 | 2022-08-11 23:12 | 0 | |
![[SND]](/icons/sound2.gif) | Maz_Korzh_Ya_pomnyu_mazellovvv.mp3 | 2022-08-11 23:04 | 7.1M | |
![[SND]](/icons/sound2.gif) | Apple TV Imp.mp3 | 2022-08-11 23:00 | 0 | |
![[SND]](/icons/sound2.gif) | v19.mp3 | 2022-08-11 22:58 | 0 | |
![[SND]](/icons/sound2.gif) | v20.mp3 | 2022-08-11 22:57 | 0 | |
![[SND]](/icons/sound2.gif) | v18.mp3 | 2022-08-11 22:57 | 0 | |
![[SND]](/icons/sound2.gif) | v17.mp3 | 2022-08-11 22:56 | 0 | |
![[SND]](/icons/sound2.gif) | yt1s.io - Tshego Morore - Project Geese (2024) (128 kbps)(1).mp3 | 2022-08-11 22:54 | 0 | |
![[SND]](/icons/sound2.gif) | Industry Baby sped up is actually fire.mp3 | 2022-08-11 22:54 | 0 | |
![[SND]](/icons/sound2.gif) | c3.mp3 | 2022-08-11 22:45 | 3.6M | |
![[SND]](/icons/sound2.gif) | c2.mp3 | 2022-08-11 22:45 | 4.8M | |
![[SND]](/icons/sound2.gif) | index.mp3 | 2022-08-11 22:44 | 98K | |
![[SND]](/icons/sound2.gif) | v15.mp3 | 2022-08-11 22:42 | 0 | |
![[SND]](/icons/sound2.gif) | v14.mp3 | 2022-08-11 22:30 | 0 | |
![[SND]](/icons/sound2.gif) | v13.mp3 | 2022-08-11 22:30 | 0 | |
![[SND]](/icons/sound2.gif) | v12.mp3 | 2022-08-11 22:29 | 0 | |
![[SND]](/icons/sound2.gif) | v11.mp3 | 2022-08-11 22:29 | 0 | |
![[SND]](/icons/sound2.gif) | v10.mp3 | 2022-08-11 22:15 | 0 | |
![[SND]](/icons/sound2.gif) | Bhjt.mp3 | 2022-08-11 22:14 | 0 | |
![[SND]](/icons/sound2.gif) | v7.mp3 | 2022-08-11 22:14 | 0 | |
![[SND]](/icons/sound2.gif) | v9.mp3 | 2022-08-11 22:13 | 0 | |
![[SND]](/icons/sound2.gif) | v8.mp3 | 2022-08-11 22:13 | 0 | |
![[SND]](/icons/sound2.gif) | instasamka-lipsi-ha-file.mp3 | 2022-08-11 22:08 | 4.8M | |
![[SND]](/icons/sound2.gif) | Keskin - Raad Yok.mp3 | 2022-08-11 22:05 | 0 | |
![[SND]](/icons/sound2.gif) | Ne1.mp3 | 2022-08-11 21:59 | 0 | |
![[SND]](/icons/sound2.gif) | Mis.m4a | 2022-08-11 21:57 | 0 | |
![[SND]](/icons/sound2.gif) | PLAZA Installer Music - 2015 - November [bThTHiM8lkM].mp3 | 2022-08-11 21:54 | 0 | |
![[SND]](/icons/sound2.gif) | Viral Tiktok..! Dj Remix SIKOK BAGI DUO - Meli __ OT Zarly Dj Dody (320 kbps).mp3 | 2022-08-11 21:50 | 0 | |
![[SND]](/icons/sound2.gif) | Shadowraze - Showdown.mp3 | 2022-08-11 21:48 | 0 | |
![[SND]](/icons/sound2.gif) | v2.mp3 | 2022-08-11 21:46 | 2.2M | |
![[SND]](/icons/sound2.gif) | v1.mp3 | 2022-08-11 21:45 | 2.3M | |
![[SND]](/icons/sound2.gif) | hfDr3ig2Vd8F.128.mp3 | 2022-08-11 21:37 | 0 | |
![[SND]](/icons/sound2.gif) | Acoustic guitar sound effect free download.mp3 | 2022-08-11 21:33 | 0 | |
![[VID]](/icons/movie.gif) | Smack My Bitch Up (2).mp4 | 2022-08-11 21:11 | 0 | |
![[VID]](/icons/movie.gif) | creweskan.mp4 | 2022-08-11 21:09 | 0 | |
![[SND]](/icons/sound2.gif) | Суета.mp3 | 2022-08-11 21:08 | 0 | |
![[SND]](/icons/sound2.gif) | turi ip ip slowed reverb------ (remake)(MP3_128K).mp3 | 2022-08-11 21:06 | 0 | |
![[SND]](/icons/sound2.gif) | Mantra Hujan - Kobo Kanaeru __ Acoustic Version (Lirik _ Lyrics _ TikTok Song)(MP3_160K).mp3 | 2022-08-11 21:06 | 0 | |
![[SND]](/icons/sound2.gif) | AMONG US REMIX (VERSI MAMANK GAROX)(MP3_320K).mp3 | 2022-08-11 21:05 | 0 | |
![[SND]](/icons/sound2.gif) | darman.mp3 | 2022-08-11 21:03 | 0 | |
![[SND]](/icons/sound2.gif) | rom1.mp3 | 2022-08-11 20:55 | 0 | |
![[SND]](/icons/sound2.gif) | Escadas - Roll Up.mp3 | 2022-08-11 20:48 | 0 | |
![[SND]](/icons/sound2.gif) | ROLEX10.mp3 | 2022-08-11 20:44 | 0 | |
![[SND]](/icons/sound2.gif) | sadalex1.mp3 | 2022-08-11 20:43 | 0 | |
![[SND]](/icons/sound2.gif) | sgK6p9bqccbnQ1100OySZqOrvNPlW10H.mp3 | 2022-08-11 20:40 | 0 | |
![[SND]](/icons/sound2.gif) | TankTrouble (1).mp3 | 2022-08-11 20:40 | 0 | |
![[SND]](/icons/sound2.gif) | TankTrouble.mp3 | 2022-08-11 20:40 | 0 | |
![[SND]](/icons/sound2.gif) | Depeche Mode - Never Let Me Down Again.mp3 | 2022-08-11 20:39 | 6.9M | |
![[SND]](/icons/sound2.gif) | Secret.mp3 | 2022-08-11 20:37 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Blingos ft EL KATIBA.mp3 | 2022-08-11 20:35 | 0 | |
![[SND]](/icons/sound2.gif) | 21-Shields-V2.0.mp3 | 2022-08-11 20:35 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Blingos ft EL KATIBA عكس السرب Clip Officiel.mp3 | 2022-08-11 20:32 | 0 | |
![[SND]](/icons/sound2.gif) | BO9AL.mp3 | 2022-08-11 20:31 | 0 | |
![[SND]](/icons/sound2.gif) | 2022-08-11 16-17-23_Trim.mp3 | 2022-08-11 20:30 | 0 | |
![[SND]](/icons/sound2.gif) | x.mp3 | 2022-08-11 20:30 | 93K | |
![[SND]](/icons/sound2.gif) | abdo.mp3 | 2022-08-11 20:22 | 308K | |
![[SND]](/icons/sound2.gif) | moro.mp3 | 2022-08-11 20:06 | 0 | |
![[SND]](/icons/sound2.gif) | DISCO.mp3 | 2022-08-11 19:59 | 0 | |
![[SND]](/icons/sound2.gif) | Kamazz - Как ты там.mp3 | 2022-08-11 19:55 | 0 | |
![[SND]](/icons/sound2.gif) | FACE_-_Biznes_72861005.mp3 | 2022-08-11 19:54 | 0 | |
![[SND]](/icons/sound2.gif) | Gay.mp3 | 2022-08-11 19:50 | 0 | |
![[SND]](/icons/sound2.gif) | Rollo Tomassi - L'homme rationnel .mp3 | 2022-08-11 19:48 | 0 | |
![[VID]](/icons/movie.gif) | Rollo Tomassi - L'homme rationnel .mp4 | 2022-08-11 19:48 | 0 | |
![[SND]](/icons/sound2.gif) | JE.mp3 | 2022-08-11 19:47 | 0 | |
![[SND]](/icons/sound2.gif) | Suwy.mp3 | 2022-08-11 19:44 | 0 | |
![[SND]](/icons/sound2.gif) | AsianF.mp3 | 2022-08-11 19:43 | 0 | |
![[SND]](/icons/sound2.gif) | grey1.mp3 | 2022-08-11 19:42 | 0 | |
![[SND]](/icons/sound2.gif) | CH.mp3 | 2022-08-11 19:40 | 112K | |
![[SND]](/icons/sound2.gif) | badang.mp3 | 2022-08-11 19:40 | 0 | |
![[VID]](/icons/movie.gif) | lv_0_20220804225837.mp4 | 2022-08-11 19:39 | 0 | |
![[SND]](/icons/sound2.gif) | MiyaGi & Andy Panda - Minor.mp3 | 2022-08-11 19:35 | 0 | |
![[SND]](/icons/sound2.gif) | EdwardBil_Psikhopt.mp3 | 2022-08-11 19:33 | 0 | |
![[SND]](/icons/sound2.gif) | LD.mp3 | 2022-08-11 19:32 | 0 | |
![[SND]](/icons/sound2.gif) | ФОНК - phonk (mp3-2020.com).mp3 | 2022-08-11 19:31 | 0 | |
![[SND]](/icons/sound2.gif) | cartoon-jump-6462.mp3 | 2022-08-11 19:31 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.com - ใจร้าย - ILLSLICK _ Cover By.Seen ft.Miguel (ฺBadguy) (128 kbps).mp3 | 2022-08-11 19:28 | 424K | |
![[SND]](/icons/sound2.gif) | Jonyy2.mp3 | 2022-08-11 19:18 | 0 | |
![[SND]](/icons/sound2.gif) | isolate.exe - crystals __ slowed + reverb.mp3 | 2022-08-11 19:11 | 0 | |
![[SND]](/icons/sound2.gif) | yatz2.mp3 | 2022-08-11 19:03 | 3.6M | |
![[SND]](/icons/sound2.gif) | dingin.mp3 | 2022-08-11 19:02 | 460K | |
![[SND]](/icons/sound2.gif) | s6.mp3 | 2022-08-11 19:01 | 2.5M | |
![[SND]](/icons/sound2.gif) | mike1.mp3 | 2022-08-11 19:00 | 2.9M | |
![[SND]](/icons/sound2.gif) | sample.mp3 | 2022-08-11 18:59 | 0 | |
![[SND]](/icons/sound2.gif) | Middle.mp3 | 2022-08-11 18:57 | 0 | |
![[SND]](/icons/sound2.gif) | CONSTANT.mp3 | 2022-08-11 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | Dahan.mp3 | 2022-08-11 18:56 | 3.3M | |
![[SND]](/icons/sound2.gif) | The Kiffness X Big Billy (Live Looping Talking Cat Remix).mp3 | 2022-08-11 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | SnapSave.io - เหลือแค่ส้วมที่ใช้ร่วมกัน (128 kbps).mp3 | 2022-08-11 18:53 | 0 | |
![[SND]](/icons/sound2.gif) | moan.mp3 | 2022-08-11 18:53 | 3.1M | |
![[SND]](/icons/sound2.gif) | Big Poppa Extreme Bass Boosted.mp3 | 2022-08-11 18:52 | 0 | |
![[SND]](/icons/sound2.gif) | rakhim-sinij-lamborghini-mp3.mp3 | 2022-08-11 18:48 | 0 | |
![[SND]](/icons/sound2.gif) | เหลือแค่ส้วมที่ใช้ร่วมกัน.mp3 | 2022-08-11 18:45 | 0 | |
![[SND]](/icons/sound2.gif) | lugowo.mp3 | 2022-08-11 18:43 | 3.1M | |
![[SND]](/icons/sound2.gif) | Keizaro6.mp3 | 2022-08-11 18:40 | 4.0M | |
![[SND]](/icons/sound2.gif) | yatz3.mp3 | 2022-08-11 18:39 | 3.2M | |
![[SND]](/icons/sound2.gif) | coffe.mp3 | 2022-08-11 18:29 | 0 | |
![[SND]](/icons/sound2.gif) | 10 - Skinheads S.H..mp3 | 2022-08-11 18:20 | 172K | |
![[SND]](/icons/sound2.gif) | dgdsgdf.mp3 | 2022-08-11 18:14 | 0 | |
![[SND]](/icons/sound2.gif) | Учения безмолвного ума. (320 kbps).mp3 | 2022-08-11 18:10 | 0 | |
![[SND]](/icons/sound2.gif) | Last_Stop.mp3 | 2022-08-11 18:09 | 0 | |
![[SND]](/icons/sound2.gif) | My-Everything_HxWSDUC-KTU.mp3 | 2022-08-11 18:05 | 0 | |
![[SND]](/icons/sound2.gif) | jony.mp3 | 2022-08-11 18:04 | 0 | |
![[SND]](/icons/sound2.gif) | Dhyo_-_Haw__Jarak_Dan_Kita___lagu_terbaru.mp3 | 2022-08-11 18:01 | 0 | |
![[SND]](/icons/sound2.gif) | ikeh1.mp3 | 2022-08-11 18:00 | 0 | |
![[SND]](/icons/sound2.gif) | senyum.mp3 | 2022-08-11 18:00 | 3.1M | |
![[SND]](/icons/sound2.gif) | Campfire Crackling warm cozy beats.mp3 | 2022-08-11 17:59 | 0 | |
![[SND]](/icons/sound2.gif) | jony1.mp3 | 2022-08-11 17:59 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - EVAN LOSS FULL SENYUM SAYANG.mp3 | 2022-08-11 17:58 | 0 | |
![[SND]](/icons/sound2.gif) | thrill_pill_polnoch.mp3 | 2022-08-11 17:56 | 0 | |
![[SND]](/icons/sound2.gif) | keren.mp3 | 2022-08-11 17:48 | 2.6M | |
![[VID]](/icons/movie.gif) | 4eb407f96ba5febdfecc87d5f4cc4125.mp4 | 2022-08-11 17:48 | 0 | |
![[SND]](/icons/sound2.gif) | Ajs_Nigrutin_Kilo_Granja_Lesim.mp3 | 2022-08-11 17:47 | 0 | |
![[SND]](/icons/sound2.gif) | DJ Reggae Come On Come On Turn The Radio X Sampe Bawah Fyp TikTok• Jaranan Dor • Alfin Revolution.mp3 | 2022-08-11 17:47 | 0 | |
![[SND]](/icons/sound2.gif) | DJ AMERICAN DREAMS X MELODY MENGKANE VIRAL TIKTOK.mp3 | 2022-08-11 17:44 | 0 | |
![[SND]](/icons/sound2.gif) | 19wmnsgsuakakan.mp3 | 2022-08-11 17:44 | 0 | |
![[SND]](/icons/sound2.gif) | Farruko - Pepas.mp3 | 2022-08-11 17:43 | 0 | |
![[SND]](/icons/sound2.gif) | farruko-pepas.mp3 | 2022-08-11 17:40 | 0 | |
![[SND]](/icons/sound2.gif) | [mileon] - L устал.mp3 | 2022-08-11 17:38 | 0 | |
![[SND]](/icons/sound2.gif) | Skriptonit_-_Mister_718_51836708.mp3 | 2022-08-11 17:34 | 0 | |
![[SND]](/icons/sound2.gif) | dj3.mp3 | 2022-08-11 17:32 | 3.4M | |
![[SND]](/icons/sound2.gif) | [EldarwaR] - II - Die Lösung.mp3 | 2022-08-11 17:29 | 0 | |
![[SND]](/icons/sound2.gif) | escltplayer8181818.mp3 | 2022-08-11 17:26 | 0 | |
![[SND]](/icons/sound2.gif) | GTA.mp3 | 2022-08-11 17:17 | 2.5M | |
![[SND]](/icons/sound2.gif) | theyn.mp3 | 2022-08-11 17:16 | 0 | |
![[VID]](/icons/movie.gif) | SnapInsta_280653172_1075198643075739_7338141745345842817_n.mp4 | 2022-08-11 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - Chad sound affect-gLeydZjRwtE-48k-1660238121260.mp3 | 2022-08-11 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | payt1.mp3 | 2022-08-11 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | payt.mp3 | 2022-08-11 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | escltplayer.mp3 | 2022-08-11 17:14 | 0 | |
![[SND]](/icons/sound2.gif) | singto.mp3 | 2022-08-11 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | videoplayback.m4a | 2022-08-11 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | ardy03.mp3 | 2022-08-11 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | ardy02.mp3 | 2022-08-11 17:08 | 0 | |
![[SND]](/icons/sound2.gif) | 144.mp3 | 2022-08-11 17:08 | 2.4M | |
![[SND]](/icons/sound2.gif) | ardy01.mp3 | 2022-08-11 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | 199.mp3 | 2022-08-11 17:06 | 0 | |
![[VID]](/icons/movie.gif) | Y2Mate.is - Batman Beatbox-ApMzw-tyHmg-720p-1660236001700 (1).mp4 | 2022-08-11 17:01 | 0 | |
![[SND]](/icons/sound2.gif) | jian25.mp3 | 2022-08-11 17:01 | 0 | |
![[SND]](/icons/sound2.gif) | jian8.mp3 | 2022-08-11 17:01 | 0 | |
![[SND]](/icons/sound2.gif) | forum_-_belaya-noch.mp3 | 2022-08-11 16:56 | 0 | |
![[SND]](/icons/sound2.gif) | tumsath.mp3 | 2022-08-11 16:51 | 0 | |
![[SND]](/icons/sound2.gif) | J_Balvin_Skrillex_-_In_Da_Getto_73025728.mp3 | 2022-08-11 16:49 | 0 | |
![[SND]](/icons/sound2.gif) | Randa2.mp3 | 2022-08-11 16:48 | 0 | |
![[SND]](/icons/sound2.gif) | Zack0.mp3 | 2022-08-11 16:47 | 0 | |
![[SND]](/icons/sound2.gif) | chippedax2.mp3 | 2022-08-11 16:46 | 0 | |
![[SND]](/icons/sound2.gif) | Zexx3.mp3 | 2022-08-11 16:42 | 0 | |
![[SND]](/icons/sound2.gif) | chippedax122.mp3 | 2022-08-11 16:41 | 0 | |
![[SND]](/icons/sound2.gif) | Zexx2.mp3 | 2022-08-11 16:41 | 0 | |
![[SND]](/icons/sound2.gif) | Wangy1.mp3 | 2022-08-11 16:41 | 0 | |
![[SND]](/icons/sound2.gif) | Randa4.mp3 | 2022-08-11 16:39 | 0 | |
![[SND]](/icons/sound2.gif) | DhemDJ11.mp3 | 2022-08-11 16:37 | 0 | |
![[SND]](/icons/sound2.gif) | Нагыз Казактын - Шешен амы (radio.lol).mp3 | 2022-08-11 16:35 | 0 | |
![[SND]](/icons/sound2.gif) | chippedax.mp3 | 2022-08-11 16:33 | 0 | |
![[SND]](/icons/sound2.gif) | Junko Yagami - Bay City (Extended Disco Mix) (www.hotplayer.ru).mp3 | 2022-08-11 16:33 | 0 | |
![[SND]](/icons/sound2.gif) | こんにちは、サルカズ傭兵のハナです.m4a | 2022-08-11 16:31 | 0 | |
![[SND]](/icons/sound2.gif) | ik100.mp3 | 2022-08-11 16:22 | 0 | |
![[SND]](/icons/sound2.gif) | Big_Baby_Tape_Molodoj_Platon_VLYuBILAS.mp3 | 2022-08-11 16:22 | 0 | |
![[SND]](/icons/sound2.gif) | ardyFNF.mp3 | 2022-08-11 16:19 | 0 | |
![[SND]](/icons/sound2.gif) | kayganda.mp3 | 2022-08-11 16:13 | 0 | |
![[SND]](/icons/sound2.gif) | Ghost_Mary_On_A_Cross.mp3 | 2022-08-11 16:10 | 0 | |
![[SND]](/icons/sound2.gif) | kamalayan.mp3 | 2022-08-11 16:10 | 2.9M | |
![[SND]](/icons/sound2.gif) | Jaydee123.mp3 | 2022-08-11 16:08 | 0 | |
![[SND]](/icons/sound2.gif) | matanda.mp3 | 2022-08-11 16:07 | 0 | |
![[SND]](/icons/sound2.gif) | lukku.mp3 | 2022-08-11 16:07 | 0 | |
![[SND]](/icons/sound2.gif) | Njan Jackson Allada DJ Remix _ DJ Strawz _ Soubin(MP3_70K).mp3 | 2022-08-11 16:07 | 716K | |
![[SND]](/icons/sound2.gif) | st7.mp3 | 2022-08-11 16:05 | 0 | |
![[SND]](/icons/sound2.gif) | FNF.mp3 | 2022-08-11 16:01 | 0 | |
![[SND]](/icons/sound2.gif) | thrill-pill-polnoch.mp3 | 2022-08-11 15:55 | 0 | |
![[SND]](/icons/sound2.gif) | Jroa.mp3 | 2022-08-11 15:55 | 0 | |
![[SND]](/icons/sound2.gif) | KAMENRIDER.mp3 | 2022-08-11 15:53 | 0 | |
![[SND]](/icons/sound2.gif) | JennieNatael1.mp3 | 2022-08-11 15:53 | 0 | |
![[SND]](/icons/sound2.gif) | fancyadamvanhammerslicemenice.mp3 | 2022-08-11 15:53 | 0 | |
![[SND]](/icons/sound2.gif) | chdn.mp3 | 2022-08-11 15:51 | 0 | |
![[SND]](/icons/sound2.gif) | JEN.mp3 | 2022-08-11 15:48 | 0 | |
![[SND]](/icons/sound2.gif) | aku.mp3 | 2022-08-11 15:44 | 0 | |
![[SND]](/icons/sound2.gif) | AMMU.mp3 | 2022-08-11 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | Herocashcash.mp3 | 2022-08-11 15:34 | 376K | |
![[SND]](/icons/sound2.gif) | dhije2.mp3 | 2022-08-11 15:34 | 3.4M | |
![[SND]](/icons/sound2.gif) | bgm1vmrp.mp3 | 2022-08-11 15:30 | 348K | |
![[SND]](/icons/sound2.gif) | miyagi.mp3 | 2022-08-11 15:29 | 0 | |
![[SND]](/icons/sound2.gif) | Sample-audio-demo.mp3 | 2022-08-11 15:29 | 0 | |
![[SND]](/icons/sound2.gif) | JIMIN (BTS) & HA SUNG WOON - With You (OST Our Blues Part.4) [320 kbps].mp3 | 2022-08-11 15:28 | 0 | |
![[SND]](/icons/sound2.gif) | 505.mp3 | 2022-08-11 15:28 | 576K | |
![[SND]](/icons/sound2.gif) | 9999.mp3 | 2022-08-11 15:26 | 0 | |
![[SND]](/icons/sound2.gif) | Reyy2.mp3 | 2022-08-11 15:20 | 0 | |
![[SND]](/icons/sound2.gif) | 55.mp3 | 2022-08-11 15:17 | 2.4M | |
![[SND]](/icons/sound2.gif) | dj2.mp3 | 2022-08-11 15:16 | 5.5M | |
![[SND]](/icons/sound2.gif) | Lyusya_CHebotina_-_SOLNCE_MONAKO_73236442.mp3 | 2022-08-11 15:16 | 0 | |
![[SND]](/icons/sound2.gif) | JAY DVRDEN-akatsuki.exe-kissvk.com.mp3 | 2022-08-11 15:15 | 0 | |
![[SND]](/icons/sound2.gif) | dj1.mp3 | 2022-08-11 15:15 | 0 | |
![[SND]](/icons/sound2.gif) | EDSON NUÑEZ DANIEL LÜDTKE GRACIA CLIPE OFICIAL.mp3 | 2022-08-11 15:13 | 0 | |
![[SND]](/icons/sound2.gif) | aarne-feat.-anikv-bushido-zho-tesno.mp3 | 2022-08-11 15:12 | 0 | |
![[SND]](/icons/sound2.gif) | Sad.mp3 | 2022-08-11 15:12 | 0 | |
![[SND]](/icons/sound2.gif) | Gazan_-_ABU_BANDIT_71958609.mp3 | 2022-08-11 15:11 | 0 | |
![[SND]](/icons/sound2.gif) | AFSAL3.mp3 | 2022-08-11 15:10 | 0 | |
![[SND]](/icons/sound2.gif) | AFSAL2.mp3 | 2022-08-11 15:09 | 0 | |
![[SND]](/icons/sound2.gif) | ASW.mp3 | 2022-08-11 15:09 | 0 | |
![[SND]](/icons/sound2.gif) | DJAKUMAU.mp3 | 2022-08-11 15:05 | 0 | |
![[SND]](/icons/sound2.gif) | Lil Uzi Vert - XO Tour Llif3 (Official Music Video) (mp3cut.net) (1).mp3 | 2022-08-11 15:00 | 0 | |
![[SND]](/icons/sound2.gif) | ข.mp3 | 2022-08-11 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | play_back.mp3 | 2022-08-11 14:45 | 0 | |
![[SND]](/icons/sound2.gif) | asekGG.mp3 | 2022-08-11 14:37 | 0 | |
![[SND]](/icons/sound2.gif) | bale1.mp3 | 2022-08-11 14:33 | 0 | |
![[SND]](/icons/sound2.gif) | Cau 3.1 - Minna - Nghe.mp3 | 2022-08-11 14:33 | 0 | |
![[SND]](/icons/sound2.gif) | Zer.mp3 | 2022-08-11 14:30 | 0 | |
![[SND]](/icons/sound2.gif) | beat.mp3 | 2022-08-11 14:29 | 5.4M | |
![[SND]](/icons/sound2.gif) | cj7.mp3 | 2022-08-11 14:25 | 0 | |
![[SND]](/icons/sound2.gif) | BBBB.mp3 | 2022-08-11 14:22 | 0 | |
![[SND]](/icons/sound2.gif) | likin.mp3 | 2022-08-11 14:22 | 0 | |
![[SND]](/icons/sound2.gif) | gedh.mp3 | 2022-08-11 14:19 | 0 | |
![[SND]](/icons/sound2.gif) | Aarne_BUSHIDO_ZHO_ANIKV_-_Tesno_74640918.mp3 | 2022-08-11 14:12 | 0 | |
![[SND]](/icons/sound2.gif) | aljona_shvec_-_Barabanshhica_73921923.mp3 | 2022-08-11 14:00 | 0 | |
![[SND]](/icons/sound2.gif) | DJRANX.mp3 | 2022-08-11 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | birthday1.mp3 | 2022-08-11 13:51 | 0 | |
![[SND]](/icons/sound2.gif) | YOYO.mp3 | 2022-08-11 13:51 | 0 | |
![[SND]](/icons/sound2.gif) | indonesia.mp3 | 2022-08-11 13:50 | 0 | |
![[SND]](/icons/sound2.gif) | lagu.mp3 | 2022-08-11 13:49 | 332K | |
![[SND]](/icons/sound2.gif) | y2mate.com - LAGU INDONESIA RAYA TEXT DAN VOCAL ORIGINAL OFFICIAL.mp3 | 2022-08-11 13:48 | 0 | |
![[SND]](/icons/sound2.gif) | sparks.mp3 | 2022-08-11 13:44 | 0 | |
![[SND]](/icons/sound2.gif) | tekit.mp3 | 2022-08-11 13:42 | 2.5M | |
![[SND]](/icons/sound2.gif) | myworld.mp3 | 2022-08-11 13:40 | 0 | |
![[SND]](/icons/sound2.gif) | Kopikap1.mp3 | 2022-08-11 13:37 | 2.5M | |
![[SND]](/icons/sound2.gif) | Hans zimmer - Interstellar No Time for Caution.mp3 | 2022-08-11 13:35 | 0 | |
![[SND]](/icons/sound2.gif) | crycgs.mp3 | 2022-08-11 13:34 | 0 | |
![[SND]](/icons/sound2.gif) | MAMA.mp3 | 2022-08-11 13:34 | 2.1M | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ SIKOK BAGI DUO REMIX VIRAL TIKTOK TERBARU 2022 JEDAG JEDUG FULL BASS DJ CAMPURAN.mp3 | 2022-08-11 13:34 | 0 | |
![[SND]](/icons/sound2.gif) | Berkelana1.mp3 | 2022-08-11 13:32 | 0 | |
![[SND]](/icons/sound2.gif) | bublegum.mp3 | 2022-08-11 13:31 | 0 | |
![[SND]](/icons/sound2.gif) | sb.mp3 | 2022-08-11 13:30 | 0 | |
![[SND]](/icons/sound2.gif) | james.mp3 | 2022-08-11 13:29 | 508K | |
![[SND]](/icons/sound2.gif) | pendhoza_pendhoza-ninggal-janji-new-version(2).mp3 | 2022-08-11 13:27 | 0 | |
![[SND]](/icons/sound2.gif) | Kopikap4.mp3 | 2022-08-11 13:27 | 0 | |
![[SND]](/icons/sound2.gif) | Phonk.mp3 | 2022-08-11 13:25 | 1.3M | |
![[SND]](/icons/sound2.gif) | Putri Kristya Gubuk Asmoro DC Musik.mp3 | 2022-08-11 13:25 | 0 | |
![[SND]](/icons/sound2.gif) | thomas.mp3 | 2022-08-11 13:24 | 3.6M | |
![[SND]](/icons/sound2.gif) | Bojo2.mp3 | 2022-08-11 13:23 | 0 | |
![[SND]](/icons/sound2.gif) | meoww1.mp3 | 2022-08-11 13:23 | 0 | |
![[SND]](/icons/sound2.gif) | Https.github.mp3 | 2022-08-11 13:21 | 0 | |
![[SND]](/icons/sound2.gif) | Denny Caknan Happy Asmara Yeni Inka Bojo Loro DC Musik(6).mp3 | 2022-08-11 13:21 | 0 | |
![[SND]](/icons/sound2.gif) | download.mp3 | 2022-08-11 13:20 | 0 | |
![[SND]](/icons/sound2.gif) | Bojo1.mp3 | 2022-08-11 13:20 | 0 | |
![[SND]](/icons/sound2.gif) | geng04.mp3 | 2022-08-11 13:18 | 756K | |
![[SND]](/icons/sound2.gif) | Everyday Normal Guy 2.mp3 | 2022-08-11 13:18 | 157K | |
![[VID]](/icons/movie.gif) | Eminem - Venom.mp4 | 2022-08-11 13:16 | 0 | |
![[SND]](/icons/sound2.gif) | Tiara1.mp3 | 2022-08-11 13:15 | 0 | |
![[SND]](/icons/sound2.gif) | Farel2.mp3 | 2022-08-11 13:15 | 0 | |
![[SND]](/icons/sound2.gif) | Satru2.mp3 | 2022-08-11 13:13 | 0 | |
![[SND]](/icons/sound2.gif) | Shade.mp3 | 2022-08-11 13:09 | 2.8M | |
![[SND]](/icons/sound2.gif) | [lagu1s.com]Gugur Bunga Versi Asli.xnkeuf-Jtqc.mp3 | 2022-08-11 13:08 | 520K | |
![[SND]](/icons/sound2.gif) | alok.mp3 | 2022-08-11 13:08 | 1.5M | |
![[SND]](/icons/sound2.gif) | Davin4.mp3 | 2022-08-11 13:07 | 0 | |
![[SND]](/icons/sound2.gif) | j-hope-bts-more-mp3.mp3 | 2022-08-11 13:07 | 0 | |
![[SND]](/icons/sound2.gif) | Davin5.mp3 | 2022-08-11 13:06 | 0 | |
![[SND]](/icons/sound2.gif) | Cheriimoya_Living_life_in_the_night_remix.mp3 | 2022-08-11 13:02 | 0 | |
![[SND]](/icons/sound2.gif) | marcocks.mp3 | 2022-08-11 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | amaremix.mp3 | 2022-08-11 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | Tom Odell - Another Love (Lyrics).mp3 | 2022-08-11 13:01 | 4.4M | |
![[SND]](/icons/sound2.gif) | 2pac-2.mp3 | 2022-08-11 12:59 | 0 | |
![[SND]](/icons/sound2.gif) | cc.mp3 | 2022-08-11 12:55 | 3.2M | |
![[SND]](/icons/sound2.gif) | White_Boy_X_Nasty_Babe_-_Dura_73283215.mp3 | 2022-08-11 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | Davin3.mp3 | 2022-08-11 12:51 | 0 | |
![[SND]](/icons/sound2.gif) | 2pac-1.mp3 | 2022-08-11 12:51 | 0 | |
![[SND]](/icons/sound2.gif) | April1.mp3 | 2022-08-11 12:51 | 0 | |
![[SND]](/icons/sound2.gif) | Ran1.mp3 | 2022-08-11 12:50 | 0 | |
![[SND]](/icons/sound2.gif) | MatritzenOperation (DJ Cannabis Coffeeshops Deutschland).mp3 | 2022-08-11 12:49 | 0 | |
![[SND]](/icons/sound2.gif) | Guyonw1.mp3 | 2022-08-11 12:49 | 936K | |
![[SND]](/icons/sound2.gif) | aa.mp3 | 2022-08-11 12:49 | 2.6M | |
![[SND]](/icons/sound2.gif) | bb.mp3 | 2022-08-11 12:48 | 836K | |
![[SND]](/icons/sound2.gif) | Mr_Lambo_Chicago_73869133.mp3 | 2022-08-11 12:46 | 0 | |
![[SND]](/icons/sound2.gif) | Duyan.mp3 | 2022-08-11 12:44 | 4.7M | |
![[SND]](/icons/sound2.gif) | misha_xramovi_-_gaichite.mp3 | 2022-08-11 12:35 | 0 | |
![[SND]](/icons/sound2.gif) | JenJoon - Soukara _ ٰسُكارَى (Official Video).mp3.mp3 | 2022-08-11 12:32 | 0 | |
![[SND]](/icons/sound2.gif) | JenJoon - Soukara _ ٰسُكارَى (Official Video).mp3 | 2022-08-11 12:30 | 0 | |
![[SND]](/icons/sound2.gif) | djakumeriang.mp3 | 2022-08-11 12:28 | 0 | |
![[SND]](/icons/sound2.gif) | Rucez.mp3 | 2022-08-11 12:25 | 604K | |
![[SND]](/icons/sound2.gif) | 9N.mp3 | 2022-08-11 12:23 | 0 | |
![[SND]](/icons/sound2.gif) | 1975.mp3 | 2022-08-11 12:19 | 0 | |
![[SND]](/icons/sound2.gif) | JJJJ.mp3 | 2022-08-11 12:18 | 1.8M | |
![[SND]](/icons/sound2.gif) | Dance13.mp3 | 2022-08-11 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | Dance12.mp3 | 2022-08-11 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | Dance11.mp3 | 2022-08-11 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | Dance10.mp3 | 2022-08-11 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | Dance9.mp3 | 2022-08-11 12:10 | 2.6M | |
![[SND]](/icons/sound2.gif) | Dance8.mp3 | 2022-08-11 12:10 | 4.1M | |
![[SND]](/icons/sound2.gif) | Dance7.mp3 | 2022-08-11 12:10 | 5.6M | |
![[SND]](/icons/sound2.gif) | Dance6.mp3 | 2022-08-11 12:10 | 3.0M | |
![[SND]](/icons/sound2.gif) | Dance5.mp3 | 2022-08-11 12:10 | 4.5M | |
![[SND]](/icons/sound2.gif) | Dance4.mp3 | 2022-08-11 12:10 | 3.8M | |
![[SND]](/icons/sound2.gif) | Dance3.mp3 | 2022-08-11 12:10 | 4.2M | |
![[SND]](/icons/sound2.gif) | Dance2.mp3 | 2022-08-11 12:10 | 3.2M | |
![[SND]](/icons/sound2.gif) | Dance02.mp3 | 2022-08-11 12:09 | 2.3M | |
![[SND]](/icons/sound2.gif) | CJWhoopty.mp3 | 2022-08-11 12:03 | 0 | |
![[SND]](/icons/sound2.gif) | VinKy15.mp3 | 2022-08-11 11:59 | 0 | |
![[SND]](/icons/sound2.gif) | Dimas7.mp3 | 2022-08-11 11:57 | 0 | |
![[SND]](/icons/sound2.gif) | Dimas1.mp3 | 2022-08-11 11:55 | 0 | |
![[SND]](/icons/sound2.gif) | VinKy8.mp3 | 2022-08-11 11:55 | 0 | |
![[SND]](/icons/sound2.gif) | SLK.mp3 | 2022-08-11 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | NANE - DOUGH THO' 💰 (video oficial).mp3 | 2022-08-11 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | meneketehe.mp3 | 2022-08-11 11:50 | 3.8M | |
![[SND]](/icons/sound2.gif) | Yen1.mp3 | 2022-08-11 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | Denn1.mp3 | 2022-08-11 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | Denn2.mp3 | 2022-08-11 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | Ek Tera Naam hai Sacha Lyrics _ ABCD2 _ Varun Dhavan __.mp3 | 2022-08-11 11:49 | 0 | |
![[SND]](/icons/sound2.gif) | Jennie.mp3 | 2022-08-11 11:46 | 0 | |
![[SND]](/icons/sound2.gif) | dkl00.mp3 | 2022-08-11 11:44 | 0 | |
![[SND]](/icons/sound2.gif) | dkl0.mp3 | 2022-08-11 11:44 | 952K | |
![[SND]](/icons/sound2.gif) | Dimas.mp3 | 2022-08-11 11:40 | 2.9M | |
![[SND]](/icons/sound2.gif) | DimasAnjayMabar.mp3 | 2022-08-11 11:39 | 0 | |
![[SND]](/icons/sound2.gif) | [MV] Rapsodi - JKT48.mp3 | 2022-08-11 11:38 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz209.mp3 | 2022-08-11 11:37 | 0 | |
![[SND]](/icons/sound2.gif) | MACAN - Без названия.mp3 | 2022-08-11 11:37 | 0 | |
![[SND]](/icons/sound2.gif) | OGJFPGJFDPGJDOFPJG.mp3 | 2022-08-11 11:37 | 0 | |
![[SND]](/icons/sound2.gif) | sweet_groove.mp3 | 2022-08-11 11:33 | 0 | |
![[SND]](/icons/sound2.gif) | IMPERATOR.mp3 | 2022-08-11 11:32 | 4.9M | |
![[SND]](/icons/sound2.gif) | 7065830654449109786.mp3 | 2022-08-11 11:32 | 0 | |
![[SND]](/icons/sound2.gif) | (FREE) Lo-fi Type Beat - I Need a Girl(MP3_160K).mp3 | 2022-08-11 11:31 | 0 | |
![[SND]](/icons/sound2.gif) | Dj Gue Mah Bodo Amat X Aku Hamil Duluan Mengkane Viral Tiktok 2022.mp3 | 2022-08-11 11:29 | 0 | |
![[SND]](/icons/sound2.gif) | Dance01.mp3 | 2022-08-11 11:27 | 3.0M | |
![[SND]](/icons/sound2.gif) | xRiltz1009.mp3 | 2022-08-11 11:26 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1010.mp3 | 2022-08-11 11:26 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1007.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1005.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1004.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1001.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1006.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1002.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1003.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz101.mp3 | 2022-08-11 11:22 | 0 | |
![[SND]](/icons/sound2.gif) | Mother Mother - Wisdom_(audiohunter.ru).mp3 | 2022-08-11 11:18 | 0 | |
![[SND]](/icons/sound2.gif) | zaur-magomadov-idet-karavan-iz-irana.mp3 | 2022-08-11 11:16 | 0 | |
![[SND]](/icons/sound2.gif) | Dushistyj_plan_Karavan_Ormars_remix.mp3 | 2022-08-11 11:12 | 3.8M | |
![[SND]](/icons/sound2.gif) | ilulsad5.mp3 | 2022-08-11 11:08 | 0 | |
![[SND]](/icons/sound2.gif) | usituru.mp3 | 2022-08-11 11:07 | 1.4M | |
![[SND]](/icons/sound2.gif) | Malamini.mp3 | 2022-08-11 11:07 | 9.0M | |
![[SND]](/icons/sound2.gif) | DJ_INILAH_AKU_RAJA_MEKSIKO_WINDAH_BASUDARA_VIRAL_TIK_TOK_TERBARU_2022(256k).mp3 | 2022-08-11 11:06 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Mahmut Orhan Ft Sena Sener Feel Extended Drop.mp3 | 2022-08-11 11:06 | 0 | |
![[SND]](/icons/sound2.gif) | jamet.mp3 | 2022-08-11 11:04 | 0 | |
![[SND]](/icons/sound2.gif) | Shiv Jan sewa.mp3 | 2022-08-11 11:02 | 0 | |
![[SND]](/icons/sound2.gif) | bodievkruzak200spectatorremix.mp3 | 2022-08-11 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | prialain.mp3 | 2022-08-11 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | ichapi5.mp3 | 2022-08-11 10:56 | 0 | |
![[SND]](/icons/sound2.gif) | StandHereAlone.mp3 | 2022-08-11 10:55 | 0 | |
![[SND]](/icons/sound2.gif) | Strong - One Direction (speed up version).mp3 | 2022-08-11 10:54 | 0 | |
![[SND]](/icons/sound2.gif) | ichapi4.mp3 | 2022-08-11 10:51 | 0 | |
![[SND]](/icons/sound2.gif) | danger.mp3 | 2022-08-11 10:51 | 831K | |
![[SND]](/icons/sound2.gif) | cartel.mp3 | 2022-08-11 10:50 | 921K | |
![[SND]](/icons/sound2.gif) | dandelions cover.mp3 | 2022-08-11 10:44 | 2.4M | |
![[SND]](/icons/sound2.gif) | AH.mp3 | 2022-08-11 10:43 | 648K | |
![[SND]](/icons/sound2.gif) | kesukaan.mp3 | 2022-08-11 10:43 | 0 | |
![[SND]](/icons/sound2.gif) | Black No. 1 (Little Miss Scare -All).mp3 | 2022-08-11 10:43 | 0 | |
![[SND]](/icons/sound2.gif) | Den1.mp3 | 2022-08-11 10:43 | 2.2M | |
![[SND]](/icons/sound2.gif) | Fav1.mp3 | 2022-08-11 10:42 | 1.0M | |
![[SND]](/icons/sound2.gif) | Jastin.mp3 | 2022-08-11 10:41 | 1.7M | |
![[SND]](/icons/sound2.gif) | fsijfs.mp3 | 2022-08-11 10:41 | 0 | |
![[SND]](/icons/sound2.gif) | DUST.mp3 | 2022-08-11 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | SDFJSDF.mp3 | 2022-08-11 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | (downloadlagu321z.net) - TRICKSTER TILL I DIED - Prod.By MANGBORIS (Official Audio) (1).mp3 | 2022-08-11 10:37 | 0 | |
![[SND]](/icons/sound2.gif) | moon.mp3 | 2022-08-11 10:36 | 80K | |
![[SND]](/icons/sound2.gif) | m3.mp3 | 2022-08-11 10:33 | 3.5M | |
![[SND]](/icons/sound2.gif) | Ninn.mp3 | 2022-08-11 10:25 | 9.3M | |
![[SND]](/icons/sound2.gif) | remix1.mp3 | 2022-08-11 10:22 | 2.7M | |
![[SND]](/icons/sound2.gif) | Jokoti(4).mp3 | 2022-08-11 10:19 | 0 | |
![[SND]](/icons/sound2.gif) | Jack.mp3 | 2022-08-11 10:18 | 0 | |
![[SND]](/icons/sound2.gif) | P9.mp3 | 2022-08-11 10:14 | 0 | |
![[SND]](/icons/sound2.gif) | MNUEIW.mp3 | 2022-08-11 10:14 | 0 | |
![[SND]](/icons/sound2.gif) | Farel Prayoga Satru 2.mp3 | 2022-08-11 10:14 | 0 | |
![[SND]](/icons/sound2.gif) | SAD1111.mp3 | 2022-08-11 10:12 | 0 | |
![[SND]](/icons/sound2.gif) | Orange.mp3 | 2022-08-11 10:12 | 0 | |
![[SND]](/icons/sound2.gif) | Jokoti(2).mp3 | 2022-08-11 10:12 | 0 | |
![[SND]](/icons/sound2.gif) | Y6mta.mp3 | 2022-08-11 10:10 | 0 | |
![[SND]](/icons/sound2.gif) | muli (2).mp3 | 2022-08-11 10:08 | 0 | |
![[SND]](/icons/sound2.gif) | Dj Fisto-B-Itz-EnRouteHouse120.mp3 | 2022-08-11 10:07 | 4.4M | |
![[SND]](/icons/sound2.gif) | kg.mp3 | 2022-08-11 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | nowbita.mp3 | 2022-08-11 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | P1.mp3 | 2022-08-11 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | Nobita.mp3 | 2022-08-11 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | KayGanda.mp3 | 2022-08-11 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | kumpas.mp3 | 2022-08-11 10:00 | 2.0M | |
![[SND]](/icons/sound2.gif) | Re-Up.mp3 | 2022-08-11 09:59 | 0 | |
![[SND]](/icons/sound2.gif) | Moira Dela Torre - Kumpas (Official Lyric Visualizer) (1).mp3 | 2022-08-11 09:57 | 0 | |
![[SND]](/icons/sound2.gif) | Marko Rudio - Ikaw lang (Nobita) cover.mp3 | 2022-08-11 09:57 | 0 | |
![[SND]](/icons/sound2.gif) | Muli- Ace Banzuelo drum cover.mp3 | 2022-08-11 09:57 | 0 | |
![[SND]](/icons/sound2.gif) | enak.mp3 | 2022-08-11 09:55 | 3.3M | |
![[SND]](/icons/sound2.gif) | m52.mp3 | 2022-08-11 09:55 | 0 | |
![[SND]](/icons/sound2.gif) | m51.mp3 | 2022-08-11 09:55 | 0 | |
![[SND]](/icons/sound2.gif) | Black Mirror Soundtrack Hang the Dj - Hours, Days, Months.mp3 | 2022-08-11 09:53 | 0 | |
![[SND]](/icons/sound2.gif) | Cash Cash-Hero.mp3 | 2022-08-11 09:53 | 0 | |
![[SND]](/icons/sound2.gif) | sakit.mp3 | 2022-08-11 09:52 | 3.5M | |
![[SND]](/icons/sound2.gif) | Comment.mp3 | 2022-08-11 09:51 | 2.6M | |
![[SND]](/icons/sound2.gif) | Cash Cash - Hero feat. Christina Perri [Official Audio].mp3 | 2022-08-11 09:46 | 0 | |
![[SND]](/icons/sound2.gif) | DJ Aku meriang.mp3 | 2022-08-11 09:42 | 2.3M | |
![[SND]](/icons/sound2.gif) | AUD-20220811-WA0000.mp3 | 2022-08-11 09:39 | 0 | |
![[SND]](/icons/sound2.gif) | DJ.AKU MERIANG MERINDUKAN KASIH SAYANG CITATA VIRAL TIKTOK fyptiktok 🎧.mp3 | 2022-08-11 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | 【明白神的旨意】第2讲(上半部分).mp3 | 2022-08-11 09:28 | 0 | |
![[SND]](/icons/sound2.gif) | mashup.mp3 | 2022-08-11 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Sound Yang Lagi Viral Di TikTok RizkiSz Dj Midua Cinta Mengkane Bootleg Raka Remixer.mp3 | 2022-08-11 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | Destroy_Lonely_-_Loyalti.mp3 | 2022-08-11 09:18 | 0 | |
![[SND]](/icons/sound2.gif) | promqueen.mp3 | 2022-08-11 09:17 | 2.0M | |
![[SND]](/icons/sound2.gif) | prom queen.mp3 | 2022-08-11 09:16 | 1.9M | |
![[SND]](/icons/sound2.gif) | X2Download.mp3 | 2022-08-11 09:14 | 0 | |
![[SND]](/icons/sound2.gif) | Pogi9.mp3 | 2022-08-11 09:13 | 0 | |
![[SND]](/icons/sound2.gif) | Duo.mp3 | 2022-08-11 09:12 | 0 | |
![[SND]](/icons/sound2.gif) | Pogi7.mp3 | 2022-08-11 09:10 | 0 | |
![[SND]](/icons/sound2.gif) | Pogi8.mp3 | 2022-08-11 09:09 | 0 | |
![[SND]](/icons/sound2.gif) | Vamos.mp3 | 2022-08-11 09:09 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - HUYỀN TÂM MÔN LẦN HẸN HÒ ĐẦU TIÊN Prod BEGINNING OFFICIAL AUDIO.mp3 | 2022-08-11 09:04 | 0 | |
![[SND]](/icons/sound2.gif) | duran-ozer-siki-baba.mp3 | 2022-08-11 09:02 | 0 | |
![[VID]](/icons/movie.gif) | اغنية كردية ريمكس عشقه ملايين من الأكراد سوراني (كوردمو كوردستانيم).mp4 | 2022-08-11 09:01 | 0 | |
![[SND]](/icons/sound2.gif) | John124.mp3 | 2022-08-11 08:56 | 2.0M | |
![[SND]](/icons/sound2.gif) | 0001.mp3 | 2022-08-11 08:55 | 0 | |
![[SND]](/icons/sound2.gif) | V.mp3 | 2022-08-11 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | mp3-now.com - Kannil Kannil Lyrical Video Sita Ramam Malayalam Dulquer Mrunal Vishal Hanu Raghavapudi_256kbps.mp3 | 2022-08-11 08:52 | 0 | |
![[SND]](/icons/sound2.gif) | zxen3.mp3 | 2022-08-11 08:50 | 0 | |
![[SND]](/icons/sound2.gif) | Pogi3.mp3 | 2022-08-11 08:48 | 0 | |
![[SND]](/icons/sound2.gif) | Pogi2.mp3 | 2022-08-11 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | Umb.mp3 | 2022-08-11 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | Pogi1.mp3 | 2022-08-11 08:46 | 0 | |
![[SND]](/icons/sound2.gif) | Yaukoshi, LXST CXNTURY Цой - Кончится Odium.mp3 | 2022-08-11 08:46 | 0 | |
![[SND]](/icons/sound2.gif) | kurd1.mp3 | 2022-08-11 08:46 | 0 | |
![[SND]](/icons/sound2.gif) | mp3-now.com - Kannil Kannil Lyrical Video Sita Ramam Malayalam Dulquer Mrunal Vishal Hanu Raghavapudi_96kbps.mp3 | 2022-08-11 08:44 | 0 | |
![[SND]](/icons/sound2.gif) | AR23.mp3 | 2022-08-11 08:41 | 0 | |
![[SND]](/icons/sound2.gif) | gio-pika-fontanchik-s-chernym-delfinom(mp3name.co).mp3 | 2022-08-11 08:40 | 0 | |
![[VID]](/icons/movie.gif) | VN20220511_184453_001.mp4 | 2022-08-11 08:38 | 0 | |
![[SND]](/icons/sound2.gif) | DjSleep82.mp3 | 2022-08-11 08:35 | 0 | |
![[SND]](/icons/sound2.gif) | KINO_-_Zakrojj_za_mnojj_dver_ya_ukhozhu_(musmore.com).mp3 | 2022-08-11 08:34 | 0 | |
![[SND]](/icons/sound2.gif) | Кино - Закрой за мной дверь я ухожу.mp3 | 2022-08-11 08:33 | 0 | |
![[SND]](/icons/sound2.gif) | AR1.mp3 | 2022-08-11 08:33 | 0 | |
![[SND]](/icons/sound2.gif) | E.C. 2151 - Demon's Tilt.mp3 | 2022-08-11 08:31 | 0 | |
![[SND]](/icons/sound2.gif) | Ezra5.mp3 | 2022-08-11 08:27 | 0 | |
![[SND]](/icons/sound2.gif) | djdesa81.mp3 | 2022-08-11 08:23 | 0 | |
![[SND]](/icons/sound2.gif) | banding.mp3 | 2022-08-11 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | DJ TANGKIS DAANG X PAPALI BERNYANYI SOUND MAHA TREND TAHUN LAHIR VIRAL TIKTOK.mp3 | 2022-08-11 08:18 | 0 | |
![[SND]](/icons/sound2.gif) | Wrrp3.mp3 | 2022-08-11 08:18 | 0 | |
![[SND]](/icons/sound2.gif) | Keizaro2.mp3 | 2022-08-11 08:18 | 3.8M | |
![[SND]](/icons/sound2.gif) | Keizaro5.mp3 | 2022-08-11 08:18 | 4.2M | |
![[SND]](/icons/sound2.gif) | Keizaro4.mp3 | 2022-08-11 08:17 | 3.8M | |
![[SND]](/icons/sound2.gif) | Keizaro9.mp3 | 2022-08-11 08:17 | 3.1M | |
![[SND]](/icons/sound2.gif) | Keizaro11.mp3 | 2022-08-11 08:17 | 2.8M | |
![[SND]](/icons/sound2.gif) | Wrrp4.mp3 | 2022-08-11 08:17 | 0 | |
![[SND]](/icons/sound2.gif) | Wrrp6.mp3 | 2022-08-11 08:16 | 0 | |
![[SND]](/icons/sound2.gif) | Powfu - Death Bed (8D Audio Lyrics) feat. Beabadoobee dont stay away for to.mp3 | 2022-08-11 08:16 | 0 | |
![[SND]](/icons/sound2.gif) | Wrrp1.mp3 | 2022-08-11 08:15 | 0 | |
![[SND]](/icons/sound2.gif) | y2meta.com - Nonstop 2022 - I Don't Know Her Name Remix - Nhạc Hot Trend Xu Hướng Tik Tok 2022 (320 kbps).mp3 | 2022-08-11 08:14 | 1.1M | |
![[SND]](/icons/sound2.gif) | R.I.P.mp3 | 2022-08-11 08:14 | 2.8M | |
![[SND]](/icons/sound2.gif) | Sakit Gigi.mp3 | 2022-08-11 08:13 | 5.5M | |
![[SND]](/icons/sound2.gif) | letiteat.mp3 | 2022-08-11 08:12 | 1.3M | |
![[SND]](/icons/sound2.gif) | pakpong.mp3 | 2022-08-11 08:11 | 496K | |
![[SND]](/icons/sound2.gif) | Boom.mp3 | 2022-08-11 08:10 | 24K | |
![[SND]](/icons/sound2.gif) | Cewo_-_Underworld_Remix_low_bass_by_ed4et_73431420.mp3 | 2022-08-11 08:08 | 0 | |
![[SND]](/icons/sound2.gif) | myoops.mp3 | 2022-08-11 08:04 | 3.5M | |
![[SND]](/icons/sound2.gif) | Thotiana.mp3 | 2022-08-11 08:04 | 2.0M | |
![[SND]](/icons/sound2.gif) | tr1.mp3 | 2022-08-11 07:54 | 15M | |
![[SND]](/icons/sound2.gif) | SHokk_-_Mne_tebe_nechego_skazat_prosti_no_ty_ne_pojmyosh_Tot_zhar_i_zhazhda_izchezli_ostalas_syrost_(iPleer.com).mp3 | 2022-08-11 07:53 | 4.6M | |
![[SND]](/icons/sound2.gif) | Kung_Ikay_Akin_-_Lyrics_by_Chocolate_Factory_[ConverteZilla.com].mp3 | 2022-08-11 07:52 | 3.8M | |
![[SND]](/icons/sound2.gif) | djkane2.mp3 | 2022-08-11 07:48 | 37M | |
![[SND]](/icons/sound2.gif) | fn.mp3 | 2022-08-11 07:47 | 5.2M | |
![[SND]](/icons/sound2.gif) | JoJo-Allopening_(allmp3.su).mp3 | 2022-08-11 07:46 | 16M | |
![[SND]](/icons/sound2.gif) | Anjay.mp3 | 2022-08-11 07:46 | 4.3M | |
![[SND]](/icons/sound2.gif) | aty.mp3 | 2022-08-11 07:45 | 8.8M | |
![[SND]](/icons/sound2.gif) | это.mp3 | 2022-08-11 07:43 | 9.3M | |
![[SND]](/icons/sound2.gif) | djkane1.mp3 | 2022-08-11 07:42 | 3.9M | |
![[SND]](/icons/sound2.gif) | sad01.mp3 | 2022-08-11 07:40 | 0 | |
![[SND]](/icons/sound2.gif) | это.mp3.mp3 | 2022-08-11 07:39 | 0 | |
![[SND]](/icons/sound2.gif) | Heartbreaking.mp3.mp3 | 2022-08-11 07:37 | 0 | |
![[SND]](/icons/sound2.gif) | djnioi.mp3 | 2022-08-11 07:37 | 0 | |
![[SND]](/icons/sound2.gif) | Teki.mp3 | 2022-08-11 07:33 | 0 | |
![[SND]](/icons/sound2.gif) | djkane.mp3 | 2022-08-11 07:32 | 212K | |
![[SND]](/icons/sound2.gif) | frien.mp3 | 2022-08-11 07:29 | 0 | |
![[SND]](/icons/sound2.gif) | fonovaja_muzika_dlja_video4_-_bez_nazvanija_(z2.fm).mp3 | 2022-08-11 07:28 | 0 | |
![[SND]](/icons/sound2.gif) | Miyagi & Andy Panda - Патрн.mp3 | 2022-08-11 07:27 | 0 | |
![[SND]](/icons/sound2.gif) | bt.mp3 | 2022-08-11 07:23 | 764K | |
![[SND]](/icons/sound2.gif) | KGC.mp3 | 2022-08-11 07:21 | 0 | |
![[SND]](/icons/sound2.gif) | orang.mp3 | 2022-08-11 07:19 | 0 | |
![[SND]](/icons/sound2.gif) | willrain.mp3 | 2022-08-11 07:19 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ MENEKETEHE X STENDING MOTOR X BANGUN TIDUR SELFIE MENGKANE.mp3 | 2022-08-11 07:19 | 3.8M | |
![[SND]](/icons/sound2.gif) | The Purge - Announcement HD.mp3 | 2022-08-11 07:15 | 0 | |
![[SND]](/icons/sound2.gif) | ktdas.mp3 | 2022-08-11 07:05 | 1.2M | |
![[SND]](/icons/sound2.gif) | Sanaallmahal.mp3 | 2022-08-11 07:05 | 1.5M | |
![[SND]](/icons/sound2.gif) | Simulashan.mp3 | 2022-08-11 07:02 | 2.8M | |
![[SND]](/icons/sound2.gif) | Halakashan.mp3 | 2022-08-11 07:02 | 2.1M | |
![[SND]](/icons/sound2.gif) | Kagome.mp3 | 2022-08-11 06:59 | 3.7M | |
![[SND]](/icons/sound2.gif) | 9naga.mp3 | 2022-08-11 06:59 | 906K | |
![[SND]](/icons/sound2.gif) | Holdme.mp3 | 2022-08-11 06:59 | 3.3M | |
![[SND]](/icons/sound2.gif) | JJ.mp3 | 2022-08-11 06:59 | 1.7M | |
![[SND]](/icons/sound2.gif) | J.mp3 | 2022-08-11 06:58 | 1.2M | |
![[SND]](/icons/sound2.gif) | Halik.mp3 | 2022-08-11 06:58 | 4.2M | |
![[SND]](/icons/sound2.gif) | Guns.mp3 | 2022-08-11 06:58 | 5.0M | |
![[SND]](/icons/sound2.gif) | Hero.mp3 | 2022-08-11 06:58 | 1.7M | |
![[SND]](/icons/sound2.gif) | Heathens.mp3 | 2022-08-11 06:58 | 3.3M | |
![[SND]](/icons/sound2.gif) | Heather.mp3 | 2022-08-11 06:58 | 2.7M | |
![[SND]](/icons/sound2.gif) | Heart.mp3 | 2022-08-11 06:58 | 2.4M | |
![[SND]](/icons/sound2.gif) | Dreams.mp3 | 2022-08-11 06:57 | 3.3M | |
![[SND]](/icons/sound2.gif) | Easyonme.mp3 | 2022-08-11 06:57 | 3.4M | |
![[SND]](/icons/sound2.gif) | end.mp3 | 2022-08-11 06:57 | 3.3M | |
![[SND]](/icons/sound2.gif) | Ganonparen.mp3 | 2022-08-11 06:57 | 2.7M | |
![[SND]](/icons/sound2.gif) | Datingtayo.mp3 | 2022-08-11 06:57 | 3.9M | |
![[SND]](/icons/sound2.gif) | Dope.mp3 | 2022-08-11 06:56 | 3.2M | |
![[SND]](/icons/sound2.gif) | Неизвестен — Зачем она берёт мужские письки в рот (www.lightaudio.ru) (1).mp3 | 2022-08-11 06:56 | 1.1M | |
![[SND]](/icons/sound2.gif) | chill.mp3 | 2022-08-11 06:56 | 2.6M | |
![[SND]](/icons/sound2.gif) | Easy.mp3 | 2022-08-11 06:56 | 127K | |
![[SND]](/icons/sound2.gif) | Again.mp3 | 2022-08-11 06:56 | 3.1M | |
![[SND]](/icons/sound2.gif) | Broken.mp3 | 2022-08-11 06:56 | 2.4M | |
![[SND]](/icons/sound2.gif) | keduoitheoanhsang.mp3 | 2022-08-11 06:56 | 0 | |
![[SND]](/icons/sound2.gif) | Angel.mp3 | 2022-08-11 06:55 | 4.0M | |
![[SND]](/icons/sound2.gif) | Bed.mp3 | 2022-08-11 06:55 | 2.7M | |
![[SND]](/icons/sound2.gif) | ACDMND.mp3 | 2022-08-11 06:55 | 4.6M | |
![[SND]](/icons/sound2.gif) | blue.mp3 | 2022-08-11 06:55 | 2.3M | |
![[SND]](/icons/sound2.gif) | balls.mp3 | 2022-08-11 06:55 | 2.7M | |
![[SND]](/icons/sound2.gif) | Atlantic.mp3 | 2022-08-11 06:55 | 2.7M | |
![[SND]](/icons/sound2.gif) | zone.mp3 | 2022-08-11 06:54 | 0 | |
![[SND]](/icons/sound2.gif) | Vp8.mp3 | 2022-08-11 06:53 | 2.4M | |
![[SND]](/icons/sound2.gif) | empiree.mp3 | 2022-08-11 06:52 | 0 | |
![[SND]](/icons/sound2.gif) | Dj3.mp3 | 2022-08-11 06:51 | 1.8M | |
![[SND]](/icons/sound2.gif) | naga.mp3 | 2022-08-11 06:51 | 0 | |
![[SND]](/icons/sound2.gif) | mikee2.mp3 | 2022-08-11 06:47 | 0 | |
![[SND]](/icons/sound2.gif) | 02.Mon_Bojhe_Na-Arijit_Singh_FusionBD.Com.mp3 | 2022-08-11 06:43 | 0 | |
![[SND]](/icons/sound2.gif) | Relax.mp3 | 2022-08-11 06:42 | 580K | |
![[SND]](/icons/sound2.gif) | ms.mp3 | 2022-08-11 06:40 | 3.3M | |
![[SND]](/icons/sound2.gif) | y2mate.com - Kẻ Theo Đuổi Ánh Sáng Lofi Ver Huy Vạc x Tiến Nguyễn x Freak D.mp3 | 2022-08-11 06:26 | 0 | |
![[SND]](/icons/sound2.gif) | gonefludd_-_kubik_lda_(zf.fm).mp3 | 2022-08-11 06:19 | 0 | |
![[SND]](/icons/sound2.gif) | ecec2.mp3 | 2022-08-11 06:19 | 0 | |
![[SND]](/icons/sound2.gif) | Marko1.mp3 | 2022-08-11 06:17 | 0 | |
![[SND]](/icons/sound2.gif) | 0608_525f_0159_1b9ea4ee07e5c709f0f2633181f994e0.mp3 | 2022-08-11 06:16 | 0 | |
![[SND]](/icons/sound2.gif) | _Mohabbat_Barsa_De__Full_Video_Song_Ft._Arjun___Creature_3D,_Surveen_Chawla_.mp3 | 2022-08-11 06:14 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Kẻ Theo Đuổi Ánh Sáng Lofi Ver Huy Vạc x Tiến Nguyễn x Freak D_320kbps.mp3 | 2022-08-11 06:13 | 0 | |
![[SND]](/icons/sound2.gif) | 02.Honved Ensemble - 02 A Nyugati Gregorian Es A Magyar Nepdal Talalkozasa.mp3 | 2022-08-11 06:11 | 0 | |
![[SND]](/icons/sound2.gif) | james19.mp3 | 2022-08-11 06:10 | 0 | |
![[SND]](/icons/sound2.gif) | james20.mp3 | 2022-08-11 06:10 | 0 | |
![[SND]](/icons/sound2.gif) | HAR10.mp3 | 2022-08-11 06:09 | 0 | |
![[SND]](/icons/sound2.gif) | HAR13.mp3 | 2022-08-11 06:09 | 4.4M | |
![[SND]](/icons/sound2.gif) | Kobo7.mp3 | 2022-08-11 06:09 | 943K | |
![[SND]](/icons/sound2.gif) | HAR4.mp3 | 2022-08-11 06:09 | 0 | |
![[SND]](/icons/sound2.gif) | HAR5.mp3 | 2022-08-11 06:09 | 0 | |
![[SND]](/icons/sound2.gif) | HAR6.mp3 | 2022-08-11 06:08 | 0 | |
![[SND]](/icons/sound2.gif) | HAR7.mp3 | 2022-08-11 06:08 | 0 | |
![[SND]](/icons/sound2.gif) | HAR8.mp3 | 2022-08-11 06:08 | 0 | |
![[SND]](/icons/sound2.gif) | HAR9.mp3 | 2022-08-11 06:08 | 0 | |
![[SND]](/icons/sound2.gif) | lil_bank_-_LVL_drift_fonk_Bassbust_(TheMP3.Info).mp3 | 2022-08-11 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | Har14.mp3 | 2022-08-11 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | Har13.mp3 | 2022-08-11 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | Har12.mp3 | 2022-08-11 06:06 | 0 | |
![[SND]](/icons/sound2.gif) | AniSh-MaHli-New-Nagpuri-Bewafa-Song-2022-Dj-Nagpuri-Song-2022-Dj-Pawan-Bedia_2q5yhjZC7uI.mp3 | 2022-08-11 06:04 | 0 | |
![[SND]](/icons/sound2.gif) | Yh.mp3 | 2022-08-11 06:02 | 3.9M | |
![[SND]](/icons/sound2.gif) | Tandi1.mp3 | 2022-08-11 06:02 | 0 | |
![[SND]](/icons/sound2.gif) | C5162.mp3 | 2022-08-11 06:01 | 0 | |
![[SND]](/icons/sound2.gif) | Close55.mp3 | 2022-08-11 06:00 | 0 | |
![[SND]](/icons/sound2.gif) | s7.mp3 | 2022-08-11 05:54 | 0 | |
![[SND]](/icons/sound2.gif) | ayaayi.mp3 | 2022-08-11 05:53 | 0 | |
![[SND]](/icons/sound2.gif) | you_win_1.mp3 | 2022-08-11 05:52 | 0 | |
![[SND]](/icons/sound2.gif) | misel.mp3 | 2022-08-11 05:48 | 388K | |
![[SND]](/icons/sound2.gif) | DJ Meneketehe VinKy ft. Abub YETE.mp3 | 2022-08-11 05:45 | 3.8M | |
![[SND]](/icons/sound2.gif) | Cosmo Sheldrake - Nightjar Wake up Call.mp3 | 2022-08-11 05:41 | 0 | |
![[SND]](/icons/sound2.gif) | Sadrrt.mp3 | 2022-08-11 05:40 | 0 | |
![[SND]](/icons/sound2.gif) | theweeknd.mp3 | 2022-08-11 05:40 | 0 | |
![[SND]](/icons/sound2.gif) | VinKy10.mp3 | 2022-08-11 05:39 | 3.1M | |
![[SND]](/icons/sound2.gif) | Shower again.m4a | 2022-08-11 05:37 | 142K | |
![[SND]](/icons/sound2.gif) | Iwas1.mp3 | 2022-08-11 05:36 | 0 | |
![[SND]](/icons/sound2.gif) | 245.mp3 | 2022-08-11 05:34 | 0 | |
![[SND]](/icons/sound2.gif) | hoh.mp3 | 2022-08-11 05:34 | 0 | |
![[SND]](/icons/sound2.gif) | hohh.mp3 | 2022-08-11 05:34 | 2.1M | |
![[SND]](/icons/sound2.gif) | Iwas.mp3 | 2022-08-11 05:33 | 0 | |
![[SND]](/icons/sound2.gif) | Wednesdaysex.m4a | 2022-08-11 05:33 | 280K | |
![[SND]](/icons/sound2.gif) | SIARAN ONLINE Mixdown 1.mp3 | 2022-08-11 05:27 | 0 | |
![[SND]](/icons/sound2.gif) | ketche.mp3 | 2022-08-11 05:26 | 0 | |
![[SND]](/icons/sound2.gif) | mybrother.mp3 | 2022-08-11 05:26 | 0 | |
![[SND]](/icons/sound2.gif) | FileMorphOutput.mp3 | 2022-08-11 05:22 | 0 | |
![[SND]](/icons/sound2.gif) | 4_6010582219926544407.mp3 | 2022-08-11 05:08 | 0 | |
![[SND]](/icons/sound2.gif) | 4_6014999348977342305.mp3 | 2022-08-11 05:07 | 0 | |
![[SND]](/icons/sound2.gif) | Alvino.mp3 | 2022-08-11 05:07 | 0 | |
![[SND]](/icons/sound2.gif) | Фая.mp3 | 2022-08-11 05:07 | 0 | |
![[SND]](/icons/sound2.gif) | [lagu1s.com]DJ KU HAMIL DULUAN REMIX __ VIRAL TIKTOK.itL8liAGKro.mp3 | 2022-08-11 05:05 | 0 | |
![[SND]](/icons/sound2.gif) | rzali.mp3 | 2022-08-11 05:03 | 0 | |
![[SND]](/icons/sound2.gif) | zz.mp3 | 2022-08-11 05:02 | 2.4M | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - Japanese Guy Yelling-UpjYTwNjWc8-160k-1660193861394-[AudioTrimmer.com].mp3 | 2022-08-11 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | elsakane5.mp3 | 2022-08-11 04:59 | 0 | |
![[SND]](/icons/sound2.gif) | HARAM.mp3 | 2022-08-11 04:54 | 1.9M | |
![[SND]](/icons/sound2.gif) | Kobo8.mp3 | 2022-08-11 04:48 | 2.7M | |
![[SND]](/icons/sound2.gif) | Kobo4.mp3 | 2022-08-11 04:45 | 0 | |
![[SND]](/icons/sound2.gif) | yy.mp3 | 2022-08-11 04:39 | 3.4M | |
![[SND]](/icons/sound2.gif) | ERIKA1.mp3 | 2022-08-11 04:38 | 0 | |
![[SND]](/icons/sound2.gif) | xy.mp3 | 2022-08-11 04:37 | 0 | |
![[SND]](/icons/sound2.gif) | xx.mp3 | 2022-08-11 04:33 | 3.3M | |
![[SND]](/icons/sound2.gif) | SEYNONSTOP.mp3 | 2022-08-11 04:33 | 0 | |
![[SND]](/icons/sound2.gif) | tw.mp3 | 2022-08-11 04:31 | 0 | |
![[SND]](/icons/sound2.gif) | Week 2 Support.mp3 | 2022-08-11 04:28 | 0 | |
![[SND]](/icons/sound2.gif) | Week 3 Support.mp3 | 2022-08-11 04:28 | 0 | |
![[SND]](/icons/sound2.gif) | Week 4 Support.mp3 | 2022-08-11 04:27 | 1.7M | |
![[SND]](/icons/sound2.gif) | Week 1 Support.mp3 | 2022-08-11 04:26 | 0 | |
![[SND]](/icons/sound2.gif) | mgc.mp3 | 2022-08-11 04:25 | 0 | |
![[SND]](/icons/sound2.gif) | Sey2.mp3 | 2022-08-11 04:25 | 0 | |
![[SND]](/icons/sound2.gif) | Bimbo.mp3 | 2022-08-11 04:23 | 0 | |
![[SND]](/icons/sound2.gif) | Rain.mp3 | 2022-08-11 04:22 | 924K | |
![[SND]](/icons/sound2.gif) | KANECOK.mp3 | 2022-08-11 04:20 | 0 | |
![[SND]](/icons/sound2.gif) | industry.mp3 | 2022-08-11 04:15 | 0 | |
![[SND]](/icons/sound2.gif) | specret.mp3 | 2022-08-11 04:14 | 0 | |
![[SND]](/icons/sound2.gif) | Daa.mp3 | 2022-08-11 04:11 | 3.3M | |
![[SND]](/icons/sound2.gif) | KG _ Nik Makino ( Lyrics ).mp3 | 2022-08-11 04:11 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Lil Nas X HOLIDAY Official Video.mp3 | 2022-08-11 04:08 | 0 | |
![[SND]](/icons/sound2.gif) | CORRUPTION - 101 OST.mp3 | 2022-08-11 04:07 | 0 | |
![[SND]](/icons/sound2.gif) | Високосный Год - Тихий Огонек.mp3 | 2022-08-11 04:03 | 0 | |
![[SND]](/icons/sound2.gif) | djviral.mp3 | 2022-08-11 04:03 | 3.8M | |
![[SND]](/icons/sound2.gif) | СИНИЕ ФИАЛКИ - The Limba (1).m4a | 2022-08-11 04:02 | 0 | |
![[SND]](/icons/sound2.gif) | Sey1.mp3 | 2022-08-11 04:02 | 0 | |
![[SND]](/icons/sound2.gif) | Sey5.mp3 | 2022-08-11 03:59 | 0 | |
![[SND]](/icons/sound2.gif) | Sey4.mp3 | 2022-08-11 03:58 | 0 | |
![[SND]](/icons/sound2.gif) | Sey3.mp3 | 2022-08-11 03:58 | 0 | |
![[SND]](/icons/sound2.gif) | walk with me1.mp3 | 2022-08-11 03:55 | 272K | |
![[SND]](/icons/sound2.gif) | Super boom 2019 Dj Ciray Nonstop bass cực phiêu.mp3 | 2022-08-11 03:50 | 0 | |
![[SND]](/icons/sound2.gif) | MIGUELA.mp3 | 2022-08-11 03:50 | 0 | |
![[SND]](/icons/sound2.gif) | Hbpasyon123.mp3 | 2022-08-11 03:46 | 0 | |
![[SND]](/icons/sound2.gif) | happy birthday remix 2021 _ happy birthday to you _ happy birthday techno budots 2021.mp3 | 2022-08-11 03:45 | 0 | |
![[SND]](/icons/sound2.gif) | audio.mp3 | 2022-08-11 03:42 | 544K | |
![[SND]](/icons/sound2.gif) | y2mate.com - Lỡ Yêu Người Đậm Sâu Lofi Ver Linh Hương Luz Cánh Hoa tàn tình tan và em bay theo gió ngàn_320kbps.mp3 | 2022-08-11 03:42 | 1.4M | |
![[SND]](/icons/sound2.gif) | funkot.mp3 | 2022-08-11 03:40 | 1.5M | |
![[SND]](/icons/sound2.gif) | BILAL1.mp3 | 2022-08-11 03:38 | 2.9M | |
![[SND]](/icons/sound2.gif) | Kira1123.mp3 | 2022-08-11 03:38 | 0 | |
![[SND]](/icons/sound2.gif) | Proyecto TQ - Fuego (OST Сыны анархии 5 сезон).mp3 | 2022-08-11 03:36 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Tương Tư Nan Tuyệt Remix Đại Thần Tuệ Top 10 Bài hát TikTok MỚI NHẤT tuần vừa qua AML MUSIC.mp3 | 2022-08-11 03:33 | 0 | |
![[SND]](/icons/sound2.gif) | hbpasyon.mp3 | 2022-08-11 03:33 | 0 | |
![[SND]](/icons/sound2.gif) | dj6.mp3 | 2022-08-11 03:31 | 436K | |
![[SND]](/icons/sound2.gif) | HBkira1.mp3 | 2022-08-11 03:31 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Lãng Tử Nhàn Thoại Thiên Tú HM Remix Thái Quỳnh Cover Hot Tiktok 2020.mp3 | 2022-08-11 03:24 | 3.9M | |
![[SND]](/icons/sound2.gif) | Virgoun - Surat Cinta Untuk Starla (Official Lyric Video).mp3 | 2022-08-11 03:24 | 4.2M | |
![[SND]](/icons/sound2.gif) | y2mate.com - Perfect Ed Sheeran Lyrics.mp3 | 2022-08-11 03:21 | 0 | |
![[SND]](/icons/sound2.gif) | TIIL I DIE1.mp3 | 2022-08-11 03:19 | 0 | |
![[SND]](/icons/sound2.gif) | sanjis01.mp3 | 2022-08-11 03:15 | 0 | |
![[SND]](/icons/sound2.gif) | sanji01.mp3 | 2022-08-11 03:13 | 0 | |
![[SND]](/icons/sound2.gif) | djkedua.mp3 | 2022-08-11 03:11 | 0 | |
![[SND]](/icons/sound2.gif) | kurdhell.mp3 | 2022-08-11 03:11 | 0 | |
![[SND]](/icons/sound2.gif) | kedua.mp3 | 2022-08-11 03:11 | 0 | |
![[SND]](/icons/sound2.gif) | egk.mp3 | 2022-08-11 03:09 | 0 | |
![[SND]](/icons/sound2.gif) | sunami1.mp3 | 2022-08-11 03:09 | 0 | |
![[SND]](/icons/sound2.gif) | ygkedua.mp3 | 2022-08-11 03:05 | 0 | |
![[SND]](/icons/sound2.gif) | (01) [Ray Manzarek] Too Close To The Sun.mp3 | 2022-08-11 03:03 | 0 | |
![[SND]](/icons/sound2.gif) | jadikan.mp3 | 2022-08-11 03:01 | 0 | |
![[SND]](/icons/sound2.gif) | Badut.mp3 | 2022-08-11 02:54 | 5.8M | |
![[SND]](/icons/sound2.gif) | mcrp.mp3 | 2022-08-11 02:53 | 0 | |
![[SND]](/icons/sound2.gif) | Qwerty.mp3 | 2022-08-11 02:50 | 0 | |
![[SND]](/icons/sound2.gif) | Smp1.mp3 | 2022-08-11 02:47 | 0 | |
![[SND]](/icons/sound2.gif) | 345345.mp3 | 2022-08-11 02:38 | 0 | |
![[SND]](/icons/sound2.gif) | 123123.mp3 | 2022-08-11 02:36 | 0 | |
![[SND]](/icons/sound2.gif) | Smile.mp3 | 2022-08-11 02:22 | 0 | |
![[SND]](/icons/sound2.gif) | Come.mp3 | 2022-08-11 02:17 | 4.1M | |
![[SND]](/icons/sound2.gif) | Buhay.mp3 | 2022-08-11 02:17 | 0 | |
![[SND]](/icons/sound2.gif) | Myself.mp3 | 2022-08-11 02:14 | 0 | |
![[SND]](/icons/sound2.gif) | Lorna Shore - To the Hellfire.mp3 | 2022-08-11 02:13 | 444K | |
![[SND]](/icons/sound2.gif) | mrp.mp3 | 2022-08-11 02:13 | 227K | |
![[SND]](/icons/sound2.gif) | jaya.mp3 | 2022-08-11 02:10 | 1.1M | |
![[SND]](/icons/sound2.gif) | 05 Montreux Inventions.mp3 | 2022-08-11 02:09 | 1.5M | |
![[SND]](/icons/sound2.gif) | (MV) JJJJ - Bung Saranghae (Prod.by บังจะบิน ).mp3.mp3 | 2022-08-11 02:06 | 0 | |
![[SND]](/icons/sound2.gif) | (MV) JJJJ - Bung Saranghae (Prod.by บังจะบิน ).mp3 | 2022-08-11 02:02 | 0 | |
![[SND]](/icons/sound2.gif) | MURDER.mp3 | 2022-08-11 01:59 | 0 | |
![[SND]](/icons/sound2.gif) | Har22.mp3 | 2022-08-11 01:57 | 0 | |
![[SND]](/icons/sound2.gif) | Har21.mp3 | 2022-08-11 01:57 | 0 | |
![[SND]](/icons/sound2.gif) | DODI.mp3 | 2022-08-11 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | Makeawishnct.mp3 | 2022-08-11 01:47 | 0 | |
![[SND]](/icons/sound2.gif) | Make a wish nct.mp3 | 2022-08-11 01:44 | 0 | |
![[SND]](/icons/sound2.gif) | Marko7.mp3 | 2022-08-11 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | Marko5.mp3 | 2022-08-11 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | Marko3.mp3 | 2022-08-11 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | Marko2.mp3 | 2022-08-11 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | Marko4.mp3 | 2022-08-11 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | Dangdut1.mp3 | 2022-08-11 01:40 | 0 | |
![[SND]](/icons/sound2.gif) | KNTL.mp3 | 2022-08-11 01:39 | 1.3M | |
![[SND]](/icons/sound2.gif) | JOKOTINGKIR.mp3 | 2022-08-11 01:37 | 0 | |
![[SND]](/icons/sound2.gif) | The Weeknd - Is There Someone Else (Official Audio).mp3 | 2022-08-11 01:33 | 0 | |
![[SND]](/icons/sound2.gif) | Die For You.mp3 | 2022-08-11 01:33 | 4.0M | |
![[SND]](/icons/sound2.gif) | YUMMY_7 (2).mp3 | 2022-08-11 01:27 | 0 | |
![[SND]](/icons/sound2.gif) | djogi.mp3 | 2022-08-11 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | power.mp3 | 2022-08-11 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | NCTUMake_A_Wish_Birthday_Song_MV_tyrVtwE8Gv0_140.mp3s.mp3 | 2022-08-11 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | morning-with-coffee-loop_GytAO4Eu.mp3 | 2022-08-11 01:20 | 0 | |
![[SND]](/icons/sound2.gif) | WhatsApp Audio 2022-08-11 at 08.13.48.mp3s.mp3 | 2022-08-11 01:16 | 340K | |
![[SND]](/icons/sound2.gif) | Jhon14.mp3 | 2022-08-11 01:09 | 0 | |
![[SND]](/icons/sound2.gif) | Jhon13.mp3 | 2022-08-11 01:08 | 0 | |
![[SND]](/icons/sound2.gif) | lian.mp3 | 2022-08-11 01:04 | 0 | |
![[SND]](/icons/sound2.gif) | ADLIN_-_Dead_Inside_73224409.mp3 | 2022-08-11 00:59 | 0 | |
![[SND]](/icons/sound2.gif) | Lagi1.mp3 | 2022-08-11 00:56 | 0 | |
![[SND]](/icons/sound2.gif) | yt1s.com - Hari ini hari ulang tahunmu Mentahan LirikAesthetic .mp3 | 2022-08-11 00:55 | 0 | |
![[SND]](/icons/sound2.gif) | momong.mp3 | 2022-08-11 00:50 | 0 | |
![[SND]](/icons/sound2.gif) | pizzapastaputitinabox.mp3 | 2022-08-11 00:47 | 0 | |
![[SND]](/icons/sound2.gif) | Phonk10.mp3 | 2022-08-11 00:42 | 0 | |
![[SND]](/icons/sound2.gif) | 8sec.mp3 | 2022-08-11 00:38 | 0 | |
![[SND]](/icons/sound2.gif) | ACDC_-_Back_In_Black_47830042.mp3 | 2022-08-11 00:38 | 892K | |
![[SND]](/icons/sound2.gif) | 🎧🎶DJ GOLDEN CROWN BREAKBEAT VIRAL TIKTOK YANG DI CARI!!🎶🎧.mp3 | 2022-08-11 00:33 | 0 | |
![[SND]](/icons/sound2.gif) | dj eyes.mp3 | 2022-08-11 00:33 | 0 | |
![[SND]](/icons/sound2.gif) | Day89.mp3 | 2022-08-11 00:32 | 0 | |
![[SND]](/icons/sound2.gif) | macarena2.mp3 | 2022-08-11 00:31 | 0 | |
![[SND]](/icons/sound2.gif) | DJ BASS BETON OLEJON OLEJON X OCOPAKELE PARTY KELUD ALL TALENT NEW REMIX.mp3 | 2022-08-11 00:31 | 0 | |
![[SND]](/icons/sound2.gif) | Dj karena kamu dj tiktok terbaru 2021 karena kamu.mp3 | 2022-08-11 00:31 | 0 | |
![[SND]](/icons/sound2.gif) | duyz.mp3 | 2022-08-11 00:30 | 0 | |
![[SND]](/icons/sound2.gif) | Words30.mp3 | 2022-08-11 00:28 | 0 | |
![[SND]](/icons/sound2.gif) | samuel_oayk.mp3 | 2022-08-11 00:26 | 0 | |
![[SND]](/icons/sound2.gif) | no.mp3 | 2022-08-11 00:21 | 256K | |
![[SND]](/icons/sound2.gif) | Yeni proje.mp3 | 2022-08-11 00:21 | 0 | |
![[SND]](/icons/sound2.gif) | after dark — mr.kitty (lyrics).mp3 | 2022-08-11 00:14 | 0 | |
![[SND]](/icons/sound2.gif) | DJ PAPA LIAT AKU BERNYANYI X PAPEPAP REMIX FULLBASS TERBARU.mp3 | 2022-08-11 00:14 | 0 | |
![[SND]](/icons/sound2.gif) | Twenty_One_Pilots_x_Stranger_Things_(getmp3.pro).mp3 | 2022-08-11 00:14 | 0 | |
![[SND]](/icons/sound2.gif) | Hoy.mp3 | 2022-08-11 00:08 | 0 | |
![[VID]](/icons/movie.gif) | PA.mp4 | 2022-08-11 00:06 | 0 | |
![[SND]](/icons/sound2.gif) | LAGU.mp3 | 2022-08-10 23:54 | 0 | |
![[SND]](/icons/sound2.gif) | WhatsApp-Ptt-2022-08-10-at-20.38.00.mp3 | 2022-08-10 23:44 | 0 | |
![[SND]](/icons/sound2.gif) | Ds39.mp3 | 2022-08-10 23:44 | 0 | |
![[SND]](/icons/sound2.gif) | Jokoti.mp3 | 2022-08-10 23:30 | 0 | |
![[SND]](/icons/sound2.gif) | Denny Caknan Happy Asmara Yeni Inka Bojo Loro DC Musik.mp3 | 2022-08-10 23:27 | 0 | |
![[SND]](/icons/sound2.gif) | nonton.mp3 | 2022-08-10 23:27 | 0 | |
![[SND]](/icons/sound2.gif) | DENNY CAKNAN X HAPPY ASMARA - SATRU 2 ( Offical Li.mp3 | 2022-08-10 23:26 | 0 | |
![[SND]](/icons/sound2.gif) | yt1s.com - حلمي تحطم واختفى اغنية مؤثرة وجميلة AMV Ahlam song IZZ ft Emy Hetari لا تفوتك.mp3 | 2022-08-10 23:13 | 0 | |
![[SND]](/icons/sound2.gif) | B.mp3 | 2022-08-10 23:04 | 550K | |
![[SND]](/icons/sound2.gif) | ЛИТВИНЕНКО - Чёрные птицы.mp3 | 2022-08-10 22:58 | 0 | |
![[SND]](/icons/sound2.gif) | nokomen.mp3 | 2022-08-10 22:57 | 0 | |
![[SND]](/icons/sound2.gif) | Arturo Mejia Virtual Pros audio.mp3 | 2022-08-10 22:55 | 0 | |
![[SND]](/icons/sound2.gif) | dj takkan.mp3 | 2022-08-10 22:43 | 0 | |
![[SND]](/icons/sound2.gif) | easy11.mp3 | 2022-08-10 22:40 | 0 | |
![[SND]](/icons/sound2.gif) | djsm-robbe-frank-moody 3sec.mp3 | 2022-08-10 22:35 | 0 | |
![[SND]](/icons/sound2.gif) | - Sēnes (320kbps) (mp3cut.net).mp3 | 2022-08-10 22:29 | 0 | |
![[SND]](/icons/sound2.gif) | Neil Cicierega - Bega Interlude (2).mp3 | 2022-08-10 22:27 | 0 | |
![[SND]](/icons/sound2.gif) | Glooco.mp3 | 2022-08-10 22:24 | 3.9M | |
![[SND]](/icons/sound2.gif) | Glouco.mp3 | 2022-08-10 22:23 | 0 | |
![[SND]](/icons/sound2.gif) | Sad1.mp3 | 2022-08-10 22:20 | 2.8M | |
![[SND]](/icons/sound2.gif) | Neil Cicierega - Bega Interlude.mp3 | 2022-08-10 22:17 | 0 | |
![[SND]](/icons/sound2.gif) | X-WAYNE, SH3TLVIZ - RAMPAGE.mp3 | 2022-08-10 22:17 | 0 | |
![[SND]](/icons/sound2.gif) | GnL2.mp3 | 2022-08-10 22:14 | 0 | |
![[SND]](/icons/sound2.gif) | GnL1.mp3 | 2022-08-10 22:13 | 0 | |
![[SND]](/icons/sound2.gif) | memetj.mp3 | 2022-08-10 22:12 | 0 | |
![[SND]](/icons/sound2.gif) | Arabic Nokia Type Beat.mp3 | 2022-08-10 22:11 | 0 | |
![[SND]](/icons/sound2.gif) | ROXIE1.mp3 | 2022-08-10 22:10 | 0 | |
![[SND]](/icons/sound2.gif) | DEAD_BLONDE_-_Malchik_Na_Devyatke_70892133.mp3 | 2022-08-10 22:09 | 0 | |
![[SND]](/icons/sound2.gif) | Miyagi& Эндшпильfeat.Ре.mp3 | 2022-08-10 22:07 | 0 | |
![[SND]](/icons/sound2.gif) | SEDIH2.mp3 | 2022-08-10 22:06 | 0 | |
![[SND]](/icons/sound2.gif) | Sad5.mp3 | 2022-08-10 22:06 | 0 | |
![[SND]](/icons/sound2.gif) | Chepz.mp3 | 2022-08-10 22:04 | 0 | |
![[SND]](/icons/sound2.gif) | SAD6.mp3 | 2022-08-10 22:02 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1660161295319 (2).mp3 | 2022-08-10 22:00 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1660161295319.mp3 | 2022-08-10 21:59 | 0 | |
![[SND]](/icons/sound2.gif) | Sedih6.mp3 | 2022-08-10 21:59 | 0 | |
![[SND]](/icons/sound2.gif) | Delusi.mp3 | 2022-08-10 21:56 | 0 | |
![[SND]](/icons/sound2.gif) | DEAD BLONDE - Мальчик на девятке.mp3 | 2022-08-10 21:39 | 8.2M | |
![[SND]](/icons/sound2.gif) | ojoban.mp3 | 2022-08-10 21:34 | 0 | |
![[SND]](/icons/sound2.gif) | Vp10.mp3 | 2022-08-10 21:30 | 440K | |
![[SND]](/icons/sound2.gif) | szum.mp3 | 2022-08-10 21:30 | 0 | |
![[SND]](/icons/sound2.gif) | Wenaro, Lxner - Лёд.mp3 | 2022-08-10 21:30 | 0 | |
![[SND]](/icons/sound2.gif) | den_vau_tong_hop_nhung_bai_hat_hay_nhat_cua_den_vau_2022_2212807356951642854 (1).mp3 | 2022-08-10 21:08 | 0 | |
![[SND]](/icons/sound2.gif) | bato bre.mp3 | 2022-08-10 20:55 | 1.2M | |
![[SND]](/icons/sound2.gif) | ss.mp3 | 2022-08-10 20:48 | 66K | |
![[SND]](/icons/sound2.gif) | oh-no-113125.mp3 | 2022-08-10 20:48 | 66K | |
![[SND]](/icons/sound2.gif) | me-hurt-sounds-40085.mp3 | 2022-08-10 20:46 | 401K | |
![[SND]](/icons/sound2.gif) | Drill1.mp3 | 2022-08-10 20:46 | 2.2M | |
![[SND]](/icons/sound2.gif) | Underworld (Slowed + Bass Boosted)@KNRD Music Support Our Second Channel🙏🏻.mp3 | 2022-08-10 20:44 | 5.6M | |
![[SND]](/icons/sound2.gif) | Песня - По блоку катит Phantom мы как всегда на стиле.mp3 | 2022-08-10 20:39 | 5.7M | |
![[SND]](/icons/sound2.gif) | VIP3.mp3 | 2022-08-10 20:37 | 46M | |
![[SND]](/icons/sound2.gif) | VIP2.mp3 | 2022-08-10 20:37 | 25M | |
![[SND]](/icons/sound2.gif) | VIP1.mp3 | 2022-08-10 20:36 | 29M | |
![[SND]](/icons/sound2.gif) | suara pintu.mp3 | 2022-08-10 20:35 | 0 | |
![[SND]](/icons/sound2.gif) | Disguise.mp3 | 2022-08-10 20:35 | 0 | |
![[SND]](/icons/sound2.gif) | Azer.mp3 | 2022-08-10 20:28 | 0 | |
![[SND]](/icons/sound2.gif) | 13.mp3 | 2022-08-10 20:24 | 4.1M | |
![[SND]](/icons/sound2.gif) | 11.mp3 | 2022-08-10 20:23 | 0 | |
![[SND]](/icons/sound2.gif) | srra16.mp3 | 2022-08-10 20:22 | 0 | |
![[SND]](/icons/sound2.gif) | thechille.mp3 | 2022-08-10 20:22 | 372K | |
![[SND]](/icons/sound2.gif) | december7.mp3 | 2022-08-10 20:17 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Fell Under a Spell Remix.mp3 | 2022-08-10 20:17 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa9.mp3 | 2022-08-10 20:15 | 0 | |
![[SND]](/icons/sound2.gif) | _DIL_KI_DOYA_HOY_NA__by_Oyshee.mp3 | 2022-08-10 20:04 | 0 | |
![[SND]](/icons/sound2.gif) | yerle-yeksan-drill-remix.mp3 | 2022-08-10 20:01 | 0 | |
![[SND]](/icons/sound2.gif) | Axepep7.mp3 | 2022-08-10 19:57 | 0 | |
![[SND]](/icons/sound2.gif) | jor1.mp3 | 2022-08-10 19:55 | 0 | |
![[SND]](/icons/sound2.gif) | memek1.mp3 | 2022-08-10 19:54 | 0 | |
![[SND]](/icons/sound2.gif) | Blood Upon the Risers -Gory Gory What a Hell of a Way to Die-.mp3 | 2022-08-10 19:52 | 0 | |
![[SND]](/icons/sound2.gif) | xcho_ty-i-ya.mp3 | 2022-08-10 19:50 | 0 | |
![[SND]](/icons/sound2.gif) | TAWA.mp3 | 2022-08-10 19:50 | 0 | |
![[SND]](/icons/sound2.gif) | pure-n-a-cnv-sound-vol-14-file.mp3 | 2022-08-10 19:48 | 0 | |
![[SND]](/icons/sound2.gif) | ❄🍷Andreyka rmx🍷❄-🚫хуй с ним🚫-kissvk.com.mp3 | 2022-08-10 19:45 | 796K | |
![[SND]](/icons/sound2.gif) | on the floor.mp3 | 2022-08-10 19:45 | 0 | |
![[SND]](/icons/sound2.gif) | AjiMat65.mp3 | 2022-08-10 19:45 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - MONSTER MASH.mp3 | 2022-08-10 19:41 | 0 | |
![[SND]](/icons/sound2.gif) | gromkaya_sirena_na_zvonok_telefona.mp3 | 2022-08-10 19:40 | 0 | |
![[SND]](/icons/sound2.gif) | Tabii.mp3 | 2022-08-10 19:38 | 0 | |
![[SND]](/icons/sound2.gif) | BalainDo5.mp3 | 2022-08-10 19:33 | 0 | |
![[SND]](/icons/sound2.gif) | B5.mp3 | 2022-08-10 19:27 | 3.6M | |
![[SND]](/icons/sound2.gif) | vasco20.mp3 | 2022-08-10 19:25 | 0 | |
![[SND]](/icons/sound2.gif) | hatiku.mp3 | 2022-08-10 19:23 | 0 | |
![[SND]](/icons/sound2.gif) | Lucy2.mp3 | 2022-08-10 19:22 | 0 | |
![[SND]](/icons/sound2.gif) | Sgt3.MP.mp3 | 2022-08-10 19:22 | 0 | |
![[SND]](/icons/sound2.gif) | vektor-a-lyudi-mp3.mp3 | 2022-08-10 19:22 | 0 | |
![[SND]](/icons/sound2.gif) | Good1.mp3 | 2022-08-10 19:22 | 0 | |
![[SND]](/icons/sound2.gif) | PETRUNSKO_BY_FAN_ONE_BASS_BOOSTE_(getmp3.pro).mp3 | 2022-08-10 19:19 | 0 | |
![[SND]](/icons/sound2.gif) | Lil_Morty_-_FLEXING_FINESSING.mp3 | 2022-08-10 19:15 | 0 | |
![[SND]](/icons/sound2.gif) | Вектор А-Люди-kissvk.com.mp3 | 2022-08-10 19:13 | 0 | |
![[SND]](/icons/sound2.gif) | Get Get Down (Bass + Pitched down).mp3 | 2022-08-10 19:03 | 0 | |
![[SND]](/icons/sound2.gif) | the new sweet groove.mp3 | 2022-08-10 19:01 | 0 | |
![[SND]](/icons/sound2.gif) | ozzy.mp3 | 2022-08-10 18:57 | 0 | |
![[SND]](/icons/sound2.gif) | John15.mp3 | 2022-08-10 18:57 | 0 | |
![[SND]](/icons/sound2.gif) | 1542027632_miyagi_-_rodnaya_poi_feat__kadi_muzonov_net.mp3 | 2022-08-10 18:57 | 0 | |
![[SND]](/icons/sound2.gif) | XXXTENTACION - Revenge (slowed & reverb)_.mp3 | 2022-08-10 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | faceit sound.mp3 | 2022-08-10 18:52 | 0 | |
![[SND]](/icons/sound2.gif) | Nba YoungBoy - Chopper City.mp3 | 2022-08-10 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | NBA YoungBoy -No Switch (music video).mp3 | 2022-08-10 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | rb.mp3 | 2022-08-10 18:50 | 0 | |
![[SND]](/icons/sound2.gif) | John125.mp3 | 2022-08-10 18:50 | 0 | |
![[SND]](/icons/sound2.gif) | quiizzzmeow_-_Aomine_Daiki_(musmore.com).mp3 | 2022-08-10 18:47 | 0 | |
![[SND]](/icons/sound2.gif) | [lagu1s.com]Angel Baby - Troye Sivan.aZX2BoxbUdk.mp3 | 2022-08-10 18:45 | 2.0M | |
![[SND]](/icons/sound2.gif) | hhh.mp3 | 2022-08-10 18:43 | 0 | |
![[SND]](/icons/sound2.gif) | req.mp3 | 2022-08-10 18:41 | 0 | |
![[SND]](/icons/sound2.gif) | yanto02.mp3 | 2022-08-10 18:40 | 0 | |
![[SND]](/icons/sound2.gif) | yanto01.mp3 | 2022-08-10 18:39 | 0 | |
![[SND]](/icons/sound2.gif) | ধুলাবালি,_Dhulabali_by_Ashes_lyrics._Unofficial_video_song.mp3 | 2022-08-10 18:34 | 0 | |
![[SND]](/icons/sound2.gif) | Troye-Sivan-Angel-Baby-Lyrics_UsBOJRIAwZo.mp3 | 2022-08-10 18:33 | 192K | |
![[SND]](/icons/sound2.gif) | jen.mp3 | 2022-08-10 18:22 | 0 | |
![[SND]](/icons/sound2.gif) | TO KILL A GOD Epic Battle Dark Heroic Music Epic Music Mix by @Audiomachine.mp3 | 2022-08-10 18:16 | 0 | |
![[SND]](/icons/sound2.gif) | YNV.mp3 | 2022-08-10 18:11 | 0 | |
![[SND]](/icons/sound2.gif) | Мельница - Бес Джиги.mp3 | 2022-08-10 18:11 | 2.3M | |
![[SND]](/icons/sound2.gif) | zatyanu.mp3 | 2022-08-10 18:09 | 0 | |
![[SND]](/icons/sound2.gif) | 22.mp3 | 2022-08-10 18:06 | 1.0M | |
![[SND]](/icons/sound2.gif) | joby3.mp3 | 2022-08-10 18:04 | 0 | |
![[SND]](/icons/sound2.gif) | joby1.mp3 | 2022-08-10 18:04 | 156K | |
![[SND]](/icons/sound2.gif) | joby2.mp3 | 2022-08-10 18:04 | 0 | |
![[SND]](/icons/sound2.gif) | verbee-odin-mp3-1.mp3 | 2022-08-10 17:56 | 0 | |
![[SND]](/icons/sound2.gif) | beograd-official-video.mp3 | 2022-08-10 17:55 | 0 | |
![[SND]](/icons/sound2.gif) | Masked Wolf - Pandemonium (Official Video).mp3 | 2022-08-10 17:54 | 0 | |
![[SND]](/icons/sound2.gif) | videoplayback.mp3 | 2022-08-10 17:54 | 2.4M | |
![[SND]](/icons/sound2.gif) | BoyWithUke - Toxic.mp3 | 2022-08-10 17:53 | 0 | |
![[SND]](/icons/sound2.gif) | Zatyany.mp3 | 2022-08-10 17:53 | 0 | |
![[SND]](/icons/sound2.gif) | asitwas .mp3 | 2022-08-10 17:53 | 2.5M | |
![[SND]](/icons/sound2.gif) | Waterflame - Swirl! (Chip-tune Remix).mp3 | 2022-08-10 17:53 | 0 | |
![[SND]](/icons/sound2.gif) | Travis_Scott_-_SICKO_MODE_ft._Drake(256k).mp3 | 2022-08-10 17:52 | 0 | |
![[SND]](/icons/sound2.gif) | ♚💔🎲LADA PRIORA 2007🎲💔♚ - Затяну шнурки потуже подойди же что ты ну же.mp3 | 2022-08-10 17:52 | 0 | |
![[SND]](/icons/sound2.gif) | ck02.mp3 | 2022-08-10 17:50 | 0 | |
![[SND]](/icons/sound2.gif) | Rhove - Shakerando (prod. Voluptyk) (TestoLyrics) (mp3cut.net).mp3 | 2022-08-10 17:49 | 0 | |
![[SND]](/icons/sound2.gif) | Shadowraze - showdown.mp3 | 2022-08-10 17:44 | 0 | |
![[SND]](/icons/sound2.gif) | УННВ - Без даты (Remix) (Remix).mp3 | 2022-08-10 17:44 | 36K | |
![[SND]](/icons/sound2.gif) | Shadowraze - shadowfiend.mp3 | 2022-08-10 17:44 | 5.5M | |
![[SND]](/icons/sound2.gif) | Shadowraze - astral step.mp3 | 2022-08-10 17:44 | 4.6M | |
![[SND]](/icons/sound2.gif) | ba9a.mp3 | 2022-08-10 17:44 | 0 | |
![[SND]](/icons/sound2.gif) | Christina_Perri_-_A_Thousand_Years_[Official_Music_Video](256k).mp3 | 2022-08-10 17:43 | 0 | |
![[SND]](/icons/sound2.gif) | dgsdg.mp3 | 2022-08-10 17:42 | 0 | |
![[SND]](/icons/sound2.gif) | 6feet.mp3 | 2022-08-10 17:39 | 0 | |
![[SND]](/icons/sound2.gif) | atldance.mp3 | 2022-08-10 17:39 | 0 | |
![[SND]](/icons/sound2.gif) | scarlxrd6feet.mp3 | 2022-08-10 17:38 | 0 | |
![[SND]](/icons/sound2.gif) | Fly Me to the Moon (Acoustic).mp3 | 2022-08-10 17:38 | 0 | |
![[SND]](/icons/sound2.gif) | rider11.mp3 | 2022-08-10 17:36 | 0 | |
![[SND]](/icons/sound2.gif) | Ba9a Ft Gharmoul - Mkarez (official music video)[Mpgun.com].mp3 | 2022-08-10 17:35 | 0 | |
![[SND]](/icons/sound2.gif) | c.mp3 | 2022-08-10 17:34 | 136K | |
![[SND]](/icons/sound2.gif) | H8.HOOD - PHANTOM.mp3 | 2022-08-10 17:32 | 0 | |
![[SND]](/icons/sound2.gif) | Oxtan2.mp3 | 2022-08-10 17:30 | 0 | |
![[SND]](/icons/sound2.gif) | sad1.mp3 | 2022-08-10 17:26 | 3.1M | |
![[SND]](/icons/sound2.gif) | YAd_Dobra_-_Vremya_molodjozhi_68701792.mp3 | 2022-08-10 17:25 | 0 | |
![[SND]](/icons/sound2.gif) | sad2.mp3 | 2022-08-10 17:25 | 1.8M | |
![[SND]](/icons/sound2.gif) | Vacation.mp3 | 2022-08-10 17:25 | 0 | |
![[SND]](/icons/sound2.gif) | roberry.mp3 | 2022-08-10 17:24 | 0 | |
![[SND]](/icons/sound2.gif) | m.mp3 | 2022-08-10 17:22 | 2.8M | |
![[SND]](/icons/sound2.gif) | pink1.mp3 | 2022-08-10 17:21 | 0 | |
![[SND]](/icons/sound2.gif) | Султан Лагучев - Любовь беда (Miro's Remix).mp3 | 2022-08-10 17:19 | 0 | |
![[SND]](/icons/sound2.gif) | ck12.mp3 | 2022-08-10 17:18 | 0 | |
![[SND]](/icons/sound2.gif) | iwgd.mp3.mp3 | 2022-08-10 17:17 | 0 | |
![[SND]](/icons/sound2.gif) | Hell March (Remastered).mp3 | 2022-08-10 17:16 | 0 | |
![[SND]](/icons/sound2.gif) | sad Dx.mp3 | 2022-08-10 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | abin.mp3 | 2022-08-10 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | Oxtan1.mp3 | 2022-08-10 17:13 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Arctic Monkeys Snap Out Of It Official Audio.mp3 | 2022-08-10 17:08 | 0 | |
![[SND]](/icons/sound2.gif) | ckrider1.mp3 | 2022-08-10 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | s1.mp3 | 2022-08-10 17:07 | 340K | |
![[SND]](/icons/sound2.gif) | Gospozha_Kaguya_v_lyubvi_kak_na_vojne_-_2_sezon_Opening_(iPleer.com).mp3 | 2022-08-10 17:04 | 3.4M | |
![[SND]](/icons/sound2.gif) | BlueWednesday.mp3 | 2022-08-10 17:02 | 2.7M | |
![[SND]](/icons/sound2.gif) | Maprider1.mp3 | 2022-08-10 16:56 | 0 | |
![[SND]](/icons/sound2.gif) | ck1.mp3.mp3 | 2022-08-10 16:51 | 0 | |
![[SND]](/icons/sound2.gif) | ck2.mp3.mp3 | 2022-08-10 16:50 | 0 | |
![[SND]](/icons/sound2.gif) | m.m4a | 2022-08-10 16:49 | 0 | |
![[SND]](/icons/sound2.gif) | maprideralle.mp3 | 2022-08-10 16:47 | 0 | |
![[SND]](/icons/sound2.gif) | munni.mp3 | 2022-08-10 16:47 | 0 | |
![[SND]](/icons/sound2.gif) | maprider.mp3 | 2022-08-10 16:46 | 0 | |
![[SND]](/icons/sound2.gif) | viral.mp3 | 2022-08-10 16:46 | 3.4M | |
![[SND]](/icons/sound2.gif) | perang.mp3 | 2022-08-10 16:46 | 1.2M | |
![[SND]](/icons/sound2.gif) | ms13.mp3 | 2022-08-10 16:46 | 2.0M | |
![[SND]](/icons/sound2.gif) | king.mp3 | 2022-08-10 16:46 | 3.0M | |
![[SND]](/icons/sound2.gif) | Wala.mp3.mp3 | 2022-08-10 16:45 | 0 | |
![[SND]](/icons/sound2.gif) | trim.09E25743-B1D4-4D53-ABE4-5B8CA3057D2E.mp3 | 2022-08-10 16:43 | 0 | |
![[SND]](/icons/sound2.gif) | Wala.mp3 | 2022-08-10 16:43 | 0 | |
![[SND]](/icons/sound2.gif) | zill100.mp3 | 2022-08-10 16:42 | 0 | |
![[SND]](/icons/sound2.gif) | chinwa probleme...عطوني..شيشة.. نطلع(MP3_320K).mp3 | 2022-08-10 16:37 | 3.4M | |
![[SND]](/icons/sound2.gif) | ck09.mp3 | 2022-08-10 16:32 | 11M | |
![[VID]](/icons/movie.gif) | Night.mp4 | 2022-08-10 16:32 | 12M | |
![[SND]](/icons/sound2.gif) | Maskoff.mp3 | 2022-08-10 16:29 | 1.7M | |
![[SND]](/icons/sound2.gif) | Chiddy-Bang-Old-Ways.mp3 | 2022-08-10 16:28 | 0 | |
![[SND]](/icons/sound2.gif) | Hang.mp3 | 2022-08-10 16:25 | 0 | |
![[SND]](/icons/sound2.gif) | vaar.mp3 | 2022-08-10 16:16 | 0 | |
![[SND]](/icons/sound2.gif) | Sancey.mp3 | 2022-08-10 16:15 | 0 | |
![[SND]](/icons/sound2.gif) | zacky4.mp3 | 2022-08-10 16:08 | 0 | |
![[SND]](/icons/sound2.gif) | purge.mp3 | 2022-08-10 16:02 | 0 | |
![[SND]](/icons/sound2.gif) | pp.mp3 | 2022-08-10 16:02 | 3.2M | |
![[SND]](/icons/sound2.gif) | S7.mp3 | 2022-08-10 15:56 | 2.4M | |
![[SND]](/icons/sound2.gif) | MALA - MORO FT PROFIT ZA3IM - STOOR - WEST ( VIDEO ANIMATION )(MP3_320K).mp3 | 2022-08-10 15:48 | 0 | |
![[SND]](/icons/sound2.gif) | MT.mp3 | 2022-08-10 15:28 | 0 | |
![[SND]](/icons/sound2.gif) | Swagging13.mp3 | 2022-08-10 15:25 | 0 | |
![[SND]](/icons/sound2.gif) | Adfi.mp3 | 2022-08-10 15:23 | 0 | |
![[SND]](/icons/sound2.gif) | KG.mp3 | 2022-08-10 15:22 | 1.7M | |
![[SND]](/icons/sound2.gif) | Misaki.mp3 | 2022-08-10 15:22 | 2.1M | |
![[SND]](/icons/sound2.gif) | Best.mp3 | 2022-08-10 15:20 | 0 | |
![[SND]](/icons/sound2.gif) | tnh.mp3 | 2022-08-10 15:19 | 0 | |
![[SND]](/icons/sound2.gif) | kyh.mp3 | 2022-08-10 15:19 | 0 | |
![[SND]](/icons/sound2.gif) | dibui.mp3 | 2022-08-10 15:18 | 0 | |
![[SND]](/icons/sound2.gif) | xipo.mp3 | 2022-08-10 15:18 | 0 | |
![[SND]](/icons/sound2.gif) | Thank you-ify jones.mp3 | 2022-08-10 15:15 | 0 | |
![[SND]](/icons/sound2.gif) | SADOP.mp3 | 2022-08-10 15:15 | 1.4M | |
![[SND]](/icons/sound2.gif) | siren.mp3 | 2022-08-10 15:15 | 6.9K | |
![[SND]](/icons/sound2.gif) | Charlie Pryce - Summer Sounds Vol 3.mp3 | 2022-08-10 15:11 | 0 | |
![[SND]](/icons/sound2.gif) | Muli.mp3 | 2022-08-10 15:11 | 4.4M | |
![[SND]](/icons/sound2.gif) | Minesr.mp3 | 2022-08-10 15:10 | 0 | |
![[SND]](/icons/sound2.gif) | Ace Banzuelo - Muli (Lyrics).mp3 | 2022-08-10 15:09 | 4.4M | |
![[SND]](/icons/sound2.gif) | a3.mp3 | 2022-08-10 15:08 | 1.9M | |
![[SND]](/icons/sound2.gif) | Bitch.mp3 | 2022-08-10 15:02 | 0 | |
![[SND]](/icons/sound2.gif) | BooM1.mp3 | 2022-08-10 14:56 | 348K | |
![[SND]](/icons/sound2.gif) | bgmusic.mp3 | 2022-08-10 14:56 | 1.7M | |
![[SND]](/icons/sound2.gif) | vikramgirl.mp3 | 2022-08-10 14:53 | 0 | |
![[SND]](/icons/sound2.gif) | DJSAD.mp3 | 2022-08-10 14:50 | 536K | |
![[SND]](/icons/sound2.gif) | Vp13.mp3 | 2022-08-10 14:49 | 2.3M | |
![[SND]](/icons/sound2.gif) | top.mp3 | 2022-08-10 14:48 | 3.1M | |
![[SND]](/icons/sound2.gif) | arcade.mp3 | 2022-08-10 14:47 | 3.9M | |
![[SND]](/icons/sound2.gif) | Maki.mp3 | 2022-08-10 14:25 | 3.5M | |
![[SND]](/icons/sound2.gif) | sateboy.mp3 | 2022-08-10 14:09 | 0 | |
![[SND]](/icons/sound2.gif) | Кореш - глаза не врут.mp3 | 2022-08-10 14:08 | 0 | |
![[SND]](/icons/sound2.gif) | Eminem & 2Pac - Björn Ironside VS Ivar The Boneless (2019).mp3 | 2022-08-10 14:07 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - no copyright music Purple lofi background music_256kbps.mp3 | 2022-08-10 14:05 | 0 | |
![[SND]](/icons/sound2.gif) | mmm.mp3 | 2022-08-10 14:04 | 2.2M | |
![[SND]](/icons/sound2.gif) | Thai3.mp3 | 2022-08-10 14:04 | 0 | |
![[SND]](/icons/sound2.gif) | Anees.mp3 | 2022-08-10 14:04 | 2.4M | |
![[SND]](/icons/sound2.gif) | Ayana2.mp3 | 2022-08-10 14:02 | 0 | |
![[SND]](/icons/sound2.gif) | Le rêve - Chococlub.mp3 | 2022-08-10 14:02 | 0 | |
![[SND]](/icons/sound2.gif) | Nm1.mp3 | 2022-08-10 14:02 | 2.6M | |
![[SND]](/icons/sound2.gif) | Hajib - Ezzin ( Medi Remix )(MP3_70K).mp3 | 2022-08-10 14:00 | 0 | |
![[SND]](/icons/sound2.gif) | orgenlampung.mp3 | 2022-08-10 13:59 | 0 | |
![[SND]](/icons/sound2.gif) | HatdogManila.mp3 | 2022-08-10 13:59 | 0 | |
![[SND]](/icons/sound2.gif) | L.mp3 | 2022-08-10 13:57 | 1.9M | |
![[SND]](/icons/sound2.gif) | wow.mp3 | 2022-08-10 13:55 | 2.1M | |
![[SND]](/icons/sound2.gif) | Vp21.mp3 | 2022-08-10 13:54 | 1.2M | |
![[SND]](/icons/sound2.gif) | Vp20.mp3 | 2022-08-10 13:54 | 2.5M | |
![[SND]](/icons/sound2.gif) | Vp19.mp3 | 2022-08-10 13:54 | 0 | |
![[SND]](/icons/sound2.gif) | Sateboy.mp3 | 2022-08-10 13:54 | 1.3M | |
![[SND]](/icons/sound2.gif) | Morshu_beatbox_loop_(getmp3.pro).mp3 | 2022-08-10 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | nhachay.mp3 | 2022-08-10 13:51 | 0 | |
![[SND]](/icons/sound2.gif) | relod.mp3 | 2022-08-10 13:49 | 256K | |
![[SND]](/icons/sound2.gif) | makna puasa.mp3 | 2022-08-10 13:49 | 0 | |
![[SND]](/icons/sound2.gif) | Bongga.mp3 | 2022-08-10 13:49 | 0 | |
![[SND]](/icons/sound2.gif) | RandaHalal.mp3 | 2022-08-10 13:45 | 0 | |
![[SND]](/icons/sound2.gif) | Lagukuu.mp3 | 2022-08-10 13:45 | 0 | |
![[SND]](/icons/sound2.gif) | [YT2mp3.info] - Unconditionally X Dandelions (Lyrics) Slowed Version (320kbps).mp3 | 2022-08-10 13:42 | 0 | |
![[SND]](/icons/sound2.gif) | Dancingqueen.mp3 | 2022-08-10 13:41 | 0 | |
![[SND]](/icons/sound2.gif) | Jamik_-_samoljotkarmv_rmx_(musportal.org).mp3 | 2022-08-10 13:39 | 0 | |
![[SND]](/icons/sound2.gif) | På Topp Final.mp3 | 2022-08-10 13:39 | 0 | |
![[SND]](/icons/sound2.gif) | Dacingqueen.mp3 | 2022-08-10 13:37 | 0 | |
![[SND]](/icons/sound2.gif) | mp12.mp3 | 2022-08-10 13:36 | 3.7M | |
![[SND]](/icons/sound2.gif) | VinKy11.mp3 | 2022-08-10 13:34 | 3.0M | |
![[SND]](/icons/sound2.gif) | RE.mp3 | 2022-08-10 13:31 | 2.9M | |
![[SND]](/icons/sound2.gif) | HD.mp3 | 2022-08-10 13:28 | 0 | |
![[SND]](/icons/sound2.gif) | awitin.mp3 | 2022-08-10 13:28 | 696K | |
![[SND]](/icons/sound2.gif) | AUD-20220605-WA0030.mp3 | 2022-08-10 13:26 | 617K | |
![[SND]](/icons/sound2.gif) | mp11.mp3 | 2022-08-10 13:26 | 3.3M | |
![[SND]](/icons/sound2.gif) | AUD-20220406-WA0026.mp3 | 2022-08-10 13:25 | 112K | |
![[SND]](/icons/sound2.gif) | lk.mp3 | 2022-08-10 13:24 | 199K | |
![[SND]](/icons/sound2.gif) | ASl.mp3 | 2022-08-10 13:24 | 0 | |
![[SND]](/icons/sound2.gif) | kl.mp3 | 2022-08-10 13:23 | 0 | |
![[SND]](/icons/sound2.gif) | huy1234.mp3 | 2022-08-10 13:21 | 0 | |
![[SND]](/icons/sound2.gif) | jh.mp3 | 2022-08-10 13:20 | 0 | |
![[SND]](/icons/sound2.gif) | Абрикоса - Влюбилась В Друга.mp3 | 2022-08-10 13:19 | 0 | |
![[SND]](/icons/sound2.gif) | หูไม่ตรงกับตา (2).mp3 | 2022-08-10 13:16 | 0 | |
![[SND]](/icons/sound2.gif) | DrawinCopyRight.mp3 | 2022-08-10 13:16 | 0 | |
![[SND]](/icons/sound2.gif) | HJ.mp3 | 2022-08-10 13:15 | 3.4M | |
![[SND]](/icons/sound2.gif) | va7.mp3 | 2022-08-10 13:11 | 0 | |
![[SND]](/icons/sound2.gif) | hg3.mp3 | 2022-08-10 13:10 | 0 | |
![[SND]](/icons/sound2.gif) | AT40 01-23-1982 #1.mp3 | 2022-08-10 13:06 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ SIKOK BAGI DUO REMIX PALEMBANG JEDAG JEDUG MENGKANE VIRAL TIKTOK_2.mp3 | 2022-08-10 13:03 | 0 | |
![[SND]](/icons/sound2.gif) | Heart of Courage.mp3 | 2022-08-10 12:58 | 2.7M | |
![[SND]](/icons/sound2.gif) | freelofi.mp3 | 2022-08-10 12:54 | 0 | |
![[SND]](/icons/sound2.gif) | Joji - Glimpse Of Us.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | yan29.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | yan25.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | yan24.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | yan23.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | yan28.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ HANING SING PUSING MUKA KAYA KINGKONG.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | yan27.mp3 | 2022-08-10 12:52 | 0 | |
![[SND]](/icons/sound2.gif) | yan26.mp3 | 2022-08-10 12:52 | 0 | |
![[SND]](/icons/sound2.gif) | janji1.mp3 | 2022-08-10 12:49 | 632K | |
![[SND]](/icons/sound2.gif) | Fellixs3.mp3 | 2022-08-10 12:49 | 0 | |
![[SND]](/icons/sound2.gif) | Fellixs2.mp3 | 2022-08-10 12:48 | 0 | |
![[SND]](/icons/sound2.gif) | A7.mp3 | 2022-08-10 12:47 | 0 | |
![[SND]](/icons/sound2.gif) | Untitled.mp3 | 2022-08-10 12:47 | 0 | |
![[SND]](/icons/sound2.gif) | Fellixs1.mp3 | 2022-08-10 12:47 | 0 | |
![[SND]](/icons/sound2.gif) | Dilemma.mp3 | 2022-08-10 12:44 | 0 | |
![[SND]](/icons/sound2.gif) | seto1.mp3 | 2022-08-10 12:43 | 0 | |
![[SND]](/icons/sound2.gif) | The Weeknd - Blinding Lights (Lyrics) (1).mp3 | 2022-08-10 12:42 | 0 | |
![[SND]](/icons/sound2.gif) | Diviners.mp3 | 2022-08-10 12:40 | 0 | |
![[SND]](/icons/sound2.gif) | A6.mp3 | 2022-08-10 12:36 | 2.8M | |
![[SND]](/icons/sound2.gif) | Vp18.mp3 | 2022-08-10 12:35 | 0 | |
![[SND]](/icons/sound2.gif) | Vp17.mp3 | 2022-08-10 12:35 | 1.6M | |
![[SND]](/icons/sound2.gif) | Vp16.mp3 | 2022-08-10 12:35 | 3.0M | |
![[SND]](/icons/sound2.gif) | Vp15.mp3 | 2022-08-10 12:35 | 3.8M | |
![[SND]](/icons/sound2.gif) | Vp14.mp3 | 2022-08-10 12:35 | 3.2M | |
![[SND]](/icons/sound2.gif) | kzsquat.mp3 | 2022-08-10 12:35 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ DOMINO MAROKO TANGKIS DANG TIIKTOK VIRAL 2022.mp3 | 2022-08-10 12:34 | 0 | |
![[SND]](/icons/sound2.gif) | FSD.mp3 | 2022-08-10 12:33 | 852K | |
![[SND]](/icons/sound2.gif) | jo.mp3 | 2022-08-10 12:33 | 3.2M | |
![[SND]](/icons/sound2.gif) | Blights.mp3 | 2022-08-10 12:32 | 0 | |
![[SND]](/icons/sound2.gif) | jk.mp3 | 2022-08-10 12:32 | 0 | |
![[SND]](/icons/sound2.gif) | KontolX1.mp3 | 2022-08-10 12:32 | 0 | |
![[SND]](/icons/sound2.gif) | MORI.mp3 | 2022-08-10 12:29 | 0 | |
![[SND]](/icons/sound2.gif) | Rahmat XxX1.mp3 | 2022-08-10 12:28 | 0 | |
![[SND]](/icons/sound2.gif) | yt1s.com - living life in the night ringtonewhatsapp status PABLO BEATS.mp3 | 2022-08-10 12:28 | 0 | |
![[SND]](/icons/sound2.gif) | ModeM_-_V_rukakh_avtomat.mp3 | 2022-08-10 12:20 | 0 | |
![[SND]](/icons/sound2.gif) | haning.mp3 | 2022-08-10 12:19 | 0 | |
![[SND]](/icons/sound2.gif) | lampung.mp3 | 2022-08-10 12:19 | 0 | |
![[SND]](/icons/sound2.gif) | basco sellout.mp3 | 2022-08-10 12:17 | 0 | |
![[SND]](/icons/sound2.gif) | Anas4.mp3 | 2022-08-10 12:17 | 0 | |
![[SND]](/icons/sound2.gif) | Anas3.mp3 | 2022-08-10 12:16 | 0 | |
![[SND]](/icons/sound2.gif) | Marcus_-_Senorita_66243016.mp3 | 2022-08-10 12:12 | 0 | |
![[SND]](/icons/sound2.gif) | LeonskyXXX1.mp3 | 2022-08-10 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | Asw.mp3 | 2022-08-10 12:11 | 4.3M | |
![[SND]](/icons/sound2.gif) | Jancokk.mp3 | 2022-08-10 12:09 | 0 | |
![[SND]](/icons/sound2.gif) | altjbreezeblocks.mp3 | 2022-08-10 12:09 | 0 | |
![[SND]](/icons/sound2.gif) | LeonskyXXX.mp3 | 2022-08-10 12:04 | 0 | |
![[SND]](/icons/sound2.gif) | joji.mp3 | 2022-08-10 12:04 | 2.7M | |
![[SND]](/icons/sound2.gif) | _Allen_GAMMATEP X LilAiNidd.mp3 | 2022-08-10 12:03 | 2.2M | |
![[SND]](/icons/sound2.gif) | lcrpbinibini.mp3 | 2022-08-10 12:00 | 144K | |
![[SND]](/icons/sound2.gif) | strong.mp3 | 2022-08-10 11:59 | 2.4M | |
![[SND]](/icons/sound2.gif) | sedaya.mp3 | 2022-08-10 11:58 | 0 | |
![[SND]](/icons/sound2.gif) | yan9.mp3 | 2022-08-10 11:58 | 5.4M | |
![[SND]](/icons/sound2.gif) | yan6.mp3 | 2022-08-10 11:58 | 8.0M | |
![[SND]](/icons/sound2.gif) | yan8.mp3 | 2022-08-10 11:57 | 3.7M | |
![[SND]](/icons/sound2.gif) | yan7.mp3 | 2022-08-10 11:57 | 4.2M | |
![[SND]](/icons/sound2.gif) | yan3.mp3 | 2022-08-10 11:57 | 5.3M | |
![[SND]](/icons/sound2.gif) | Keep You Safe Yahya.mp3 | 2022-08-10 11:57 | 0 | |
![[SND]](/icons/sound2.gif) | yan5.mp3 | 2022-08-10 11:57 | 1.9M | |
![[SND]](/icons/sound2.gif) | yan4.mp3 | 2022-08-10 11:57 | 4.8M | |
![[SND]](/icons/sound2.gif) | yan21.mp3 | 2022-08-10 11:56 | 5.5M | |
![[SND]](/icons/sound2.gif) | yan22.mp3 | 2022-08-10 11:56 | 7.9M | |
![[SND]](/icons/sound2.gif) | yan20.mp3 | 2022-08-10 11:56 | 5.4M | |
![[SND]](/icons/sound2.gif) | yan2.mp3 | 2022-08-10 11:56 | 4.9M | |
![[SND]](/icons/sound2.gif) | yan13.mp3 | 2022-08-10 11:56 | 7.1M | |
![[SND]](/icons/sound2.gif) | yan19.mp3 | 2022-08-10 11:55 | 4.8M | |
![[SND]](/icons/sound2.gif) | yan15.mp3 | 2022-08-10 11:55 | 5.3M | |
![[SND]](/icons/sound2.gif) | yan18.mp3 | 2022-08-10 11:55 | 2.2M | |
![[SND]](/icons/sound2.gif) | yan16.mp3 | 2022-08-10 11:55 | 3.6M | |
![[SND]](/icons/sound2.gif) | yan14.mp3 | 2022-08-10 11:55 | 3.4M | |
![[SND]](/icons/sound2.gif) | yan17.mp3 | 2022-08-10 11:55 | 2.4M | |
![[SND]](/icons/sound2.gif) | yan12.mp3 | 2022-08-10 11:55 | 5.8M | |
![[SND]](/icons/sound2.gif) | yan01.mp3 | 2022-08-10 11:55 | 6.0M | |
![[SND]](/icons/sound2.gif) | yan11.mp3 | 2022-08-10 11:55 | 2.8M | |
![[SND]](/icons/sound2.gif) | yan10.mp3 | 2022-08-10 11:55 | 3.8M | |
![[SND]](/icons/sound2.gif) | yan1.mp3 | 2022-08-10 11:54 | 3.6M | |
![[SND]](/icons/sound2.gif) | yan000.mp3 | 2022-08-10 11:54 | 3.2M | |
![[SND]](/icons/sound2.gif) | yan00.mp3 | 2022-08-10 11:54 | 3.2M | |
![[SND]](/icons/sound2.gif) | yan0.mp3 | 2022-08-10 11:54 | 4.6M | |
![[SND]](/icons/sound2.gif) | Phonk7.mp3 | 2022-08-10 11:54 | 1.1M | |
![[SND]](/icons/sound2.gif) | toge0.mp3 | 2022-08-10 11:54 | 0 | |
![[SND]](/icons/sound2.gif) | [lagu1s.com]DJ RINDU SEMALAM REMIX VIRAL TIKTOK TERBARU 2022 SEMALAM KU TAHAN KU TAHAN SEMALAM.HoPh8FM0h_E.mp3 | 2022-08-10 11:54 | 0 | |
![[SND]](/icons/sound2.gif) | Phonk6.mp3 | 2022-08-10 11:54 | 2.1M | |
![[SND]](/icons/sound2.gif) | Miyagi_JEndshpil_-_BadaBum_70693181.mp3 | 2022-08-10 11:54 | 0 | |
![[SND]](/icons/sound2.gif) | Phonk9.mp3 | 2022-08-10 11:54 | 1.8M | |
![[SND]](/icons/sound2.gif) | lcrpmahika.mp3 | 2022-08-10 11:54 | 380K | |
![[SND]](/icons/sound2.gif) | Phonk8.mp3 | 2022-08-10 11:54 | 1.8M | |
![[SND]](/icons/sound2.gif) | Phonk5.mp3 | 2022-08-10 11:53 | 2.2M | |
![[SND]](/icons/sound2.gif) | Phonk4.mp3 | 2022-08-10 11:53 | 1.8M | |
![[SND]](/icons/sound2.gif) | Phonk3.mp3 | 2022-08-10 11:53 | 1.9M | |
![[SND]](/icons/sound2.gif) | Alt-J () _ Breezeblocks Lyrics (HQ).mp3 | 2022-08-10 11:53 | 0 | |
![[SND]](/icons/sound2.gif) | 𝕐𝒫𝒜人Ѣ𝓒𝓀𝖀𝕌-† - Блатная походка бандит 🍷-kissvk.com.mp3 | 2022-08-10 11:52 | 0 | |
![[SND]](/icons/sound2.gif) | rep.mp3 | 2022-08-10 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | Phonk2.mp3 | 2022-08-10 11:49 | 2.0M | |
![[SND]](/icons/sound2.gif) | onlymp3.to - Alt-J (∆) _ Breezeblocks Lyrics (HQ)-kT6pFsVA6hA-192k-1660040896941.mp3 | 2022-08-10 11:48 | 652K | |
![[SND]](/icons/sound2.gif) | Phonk1.mp3 | 2022-08-10 11:47 | 1.3M | |
![[SND]](/icons/sound2.gif) | Uta1.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | TOTTO69.mp3 | 2022-08-10 11:47 | 11M | |
![[SND]](/icons/sound2.gif) | TOTTO61.mp3 | 2022-08-10 11:47 | 6.3M | |
![[SND]](/icons/sound2.gif) | TOTTO67.mp3 | 2022-08-10 11:47 | 4.8M | |
![[SND]](/icons/sound2.gif) | DUKH1.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | TOTTO68.mp3 | 2022-08-10 11:47 | 9.7M | |
![[SND]](/icons/sound2.gif) | TTA2.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | SAD2.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | TOTTO70.mp3 | 2022-08-10 11:47 | 8.8M | |
![[SND]](/icons/sound2.gif) | TTA1.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | TOTTO72.mp3 | 2022-08-10 11:47 | 3.2M | |
![[SND]](/icons/sound2.gif) | TOTTO71.mp3 | 2022-08-10 11:47 | 3.3M | |
![[SND]](/icons/sound2.gif) | TOTTO80.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | VANIX.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | sw8.mp3 | 2022-08-10 11:46 | 0 | |
![[SND]](/icons/sound2.gif) | sw7.mp3 | 2022-08-10 11:45 | 0 | |
![[SND]](/icons/sound2.gif) | sw5.mp3 | 2022-08-10 11:45 | 0 | |
![[SND]](/icons/sound2.gif) | sw6.mp3 | 2022-08-10 11:45 | 0 | |
![[SND]](/icons/sound2.gif) | Mentahan ccp 30 detik lirik DJ Darkside by alan Walker.mp3 | 2022-08-10 11:44 | 0 | |
![[SND]](/icons/sound2.gif) | Ply2.mp3 | 2022-08-10 11:44 | 0 | |
![[SND]](/icons/sound2.gif) | 𝙙𝙧c3.mp3 | 2022-08-10 11:44 | 0 | |
![[SND]](/icons/sound2.gif) | sw4.mp3 | 2022-08-10 11:44 | 0 | |
![[SND]](/icons/sound2.gif) | Harble-БЕН x Daycare Theme -FNAF Security Breach OST--kissvk.com.mp3 | 2022-08-10 11:43 | 0 | |
![[SND]](/icons/sound2.gif) | alok1.mp3 | 2022-08-10 11:42 | 213K | |
![[SND]](/icons/sound2.gif) | Playboi.mp3 | 2022-08-10 11:41 | 0 | |
![[SND]](/icons/sound2.gif) | 𝙙𝙧4𝙘𝙤.mp3 | 2022-08-10 11:40 | 0 | |
![[SND]](/icons/sound2.gif) | 🥀💉Stetex💉🥀-🌪️niko and the niners🌪️-kissvk.com.mp3 | 2022-08-10 11:40 | 0 | |
![[SND]](/icons/sound2.gif) | —ʀ ᴀ s т ᴀ ғ ᴀ ʀ ɪ 🌴-Я знаю ты долеко - RMX --kissvk.com.mp3 | 2022-08-10 11:39 | 0 | |
![[SND]](/icons/sound2.gif) | 🔊💣😈Iliusha🔊💣😈-🌴𝕃𝔼𝕊𝕋𝔻𝕌𝕀𝕋🌴-kissvk.com.mp3 | 2022-08-10 11:38 | 0 | |
![[SND]](/icons/sound2.gif) | derevna.mp3 | 2022-08-10 11:37 | 0 | |
![[VID]](/icons/movie.gif) | f9336b6ba13bc84e1892b24f69375c5e.mp4 | 2022-08-10 11:37 | 0 | |
![[SND]](/icons/sound2.gif) | y2meta.com - DJ Dash Uciha Plis Ku Tak Suka Preman Slow Tik Tok Remix Terbaru 2021 (DJ Cantik Remix) (320 kbps).mp3 | 2022-08-10 11:37 | 0 | |
![[VID]](/icons/movie.gif) | Video-xin-vinh-biet-cu-www_tiengdong_com.mp4 | 2022-08-10 11:36 | 0 | |
![[SND]](/icons/sound2.gif) | bro hayuk mabar bro.mp3 | 2022-08-10 11:35 | 0 | |
![[SND]](/icons/sound2.gif) | smsa.mp3 | 2022-08-10 11:33 | 0 | |
![[SND]](/icons/sound2.gif) | 𝙙𝙧4𝙘𝙤 - 𝙛𝙧𝙖𝙢𝙚𝙙「 𝙨𝙥𝙚𝙙 𝙪𝙥 」.mp3 | 2022-08-10 11:29 | 0 | |
![[SND]](/icons/sound2.gif) | herbaltea.mp3 | 2022-08-10 11:29 | 0 | |
![[SND]](/icons/sound2.gif) | 1657269509300_track.mp3 | 2022-08-10 11:27 | 0 | |
![[SND]](/icons/sound2.gif) | Francesco Sartori & Sir James Galway - Time To Say Goodbye (megasongs.me).mp3 | 2022-08-10 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | vipusk.mp3.mp3 | 2022-08-10 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | snobbism.mp3 | 2022-08-10 11:24 | 0 | |
![[SND]](/icons/sound2.gif) | KK.mp3 | 2022-08-10 11:24 | 1.2M | |
![[SND]](/icons/sound2.gif) | TikTok.mp3 | 2022-08-10 11:23 | 5.0M | |
![[SND]](/icons/sound2.gif) | konfuz-kajf-ty-pojmala-alexei-shkurko-remix-mp3.mp3 | 2022-08-10 11:20 | 0 | |
![[SND]](/icons/sound2.gif) | 25-meiko.mp3 | 2022-08-10 11:20 | 0 | |
![[SND]](/icons/sound2.gif) | LIZER_Moi_ruki_ne_krylya_da_i_lyudi_ne_pticy.mp3 | 2022-08-10 11:20 | 0 | |
![[SND]](/icons/sound2.gif) | alex-andreev-gip-y-prince-padal-belyj-sneg.mp3 | 2022-08-10 11:20 | 0 | |
![[SND]](/icons/sound2.gif) | Ислам Итляшев - Ой ой ой сердце думай головой (mp3day.net).mp3 | 2022-08-10 11:20 | 0 | |
![[SND]](/icons/sound2.gif) | KIRYA_NASVAEV_-_MATIZ_nightcore_bassboost_74153549.mp3 | 2022-08-10 11:19 | 0 | |
![[SND]](/icons/sound2.gif) | ck.mp3.mp3 | 2022-08-10 11:18 | 888K | |
![[SND]](/icons/sound2.gif) | Zx.mp3 | 2022-08-10 11:16 | 0 | |
![[SND]](/icons/sound2.gif) | HerbalTea.mp3 | 2022-08-10 11:15 | 0 | |
![[SND]](/icons/sound2.gif) | _Salahkah kita_-robinhood ft asmirandah..mp3 | 2022-08-10 11:14 | 0 | |
![[SND]](/icons/sound2.gif) | paa.mp3.mp3 | 2022-08-10 11:13 | 0 | |
![[SND]](/icons/sound2.gif) | Ariel.mp3 | 2022-08-10 11:11 | 0 | |
![[SND]](/icons/sound2.gif) | Paa Sa Lupa Pilyo Gang Ft JCF.mp3 | 2022-08-10 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | ཌ乂卂爪乇尺ད - 𝐒𝐍𝐎𝐖.mp3 | 2022-08-10 11:08 | 0 | |
![[VID]](/icons/movie.gif) | 5efada2250010dd06d5bfc8448fedfbc.mp4 | 2022-08-10 11:07 | 0 | |
![[SND]](/icons/sound2.gif) | GAYAZOV$ BROTHER$ - СИНИЙ ИНЕЙ.mp3 | 2022-08-10 11:04 | 0 | |
![[SND]](/icons/sound2.gif) | sktzxx.mp3 | 2022-08-10 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | TUG.mp3 | 2022-08-10 11:00 | 0 | |
![[VID]](/icons/movie.gif) | 8e178bc25390c1107022f148bb786f2e.mp4 | 2022-08-10 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | lkdj.mp3 | 2022-08-10 10:55 | 0 | |
![[SND]](/icons/sound2.gif) | Üsma.m4a | 2022-08-10 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | MATRANG - ПАТРИАРХАТ (1).mp3 | 2022-08-10 10:48 | 848K | |
![[SND]](/icons/sound2.gif) | Vip4.mp3 | 2022-08-10 10:48 | 3.8M | |
![[SND]](/icons/sound2.gif) | ilham10.mp3 | 2022-08-10 10:47 | 2.8M | |
![[SND]](/icons/sound2.gif) | Masteran 1 jam untuk murai batu isian lengkap.mp3 | 2022-08-10 10:45 | 0 | |
![[SND]](/icons/sound2.gif) | ลลา นกบนหลาดง White-rumped shama Display.mp3 | 2022-08-10 10:44 | 452K | |
![[SND]](/icons/sound2.gif) | BUDOTS.mp3 | 2022-08-10 10:44 | 15M | |
![[SND]](/icons/sound2.gif) | Suara pikat burung sertu 100 ampuh!!! Dan memancing sertu yg macet bunyi.mp3 | 2022-08-10 10:44 | 0 | |
![[SND]](/icons/sound2.gif) | Masteran Favorit Murai Batu Suara Burung 3 In 1. Tengkek Buto, Cililin, Kapas Tembak.mp3 | 2022-08-10 10:44 | 0 | |
![[SND]](/icons/sound2.gif) | sw3.mp3 | 2022-08-10 10:43 | 0 | |
![[SND]](/icons/sound2.gif) | ChuChu TV Baby Shark - Good Habits and Many More Videos Popular Nursery Rhymes Collection.mp3 | 2022-08-10 10:43 | 0 | |
![[SND]](/icons/sound2.gif) | Ne2.mp3 | 2022-08-10 10:42 | 0 | |
![[SND]](/icons/sound2.gif) | Suara burung cipohsirtu cocok buat mancing jantan.mp3 | 2022-08-10 10:42 | 0 | |
![[SND]](/icons/sound2.gif) | Johny Johny Yes Papa Ball Pit Show - ChuChu TV 3D Baby Songs & Nursery Rhymes for Kids.mp3 | 2022-08-10 10:42 | 0 | |
![[SND]](/icons/sound2.gif) | sw2.mp3 | 2022-08-10 10:42 | 0 | |
![[SND]](/icons/sound2.gif) | Baby goes to Old MacDonalds Farm + More ChuChu TV Baby Nursery Rhymes & Kids Songs.mp3 | 2022-08-10 10:41 | 0 | |
![[SND]](/icons/sound2.gif) | 10AGE_-_Malyshka_74140548.mp3 | 2022-08-10 10:41 | 0 | |
![[SND]](/icons/sound2.gif) | Baby's Humpty Dumpty Song + More ChuChu TV Baby Nursery Rhymes & Kids Songs.mp3 | 2022-08-10 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | Andery_Toronto_Diman_Bryukhanov_-_Karavan_73442350.mp3 | 2022-08-10 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | Pat a Cake + Many more Nursery Rhymes & Kids Songs - ChuChu TV LIVE.mp3 | 2022-08-10 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | Happy Kid's Cartoon Music Background.mp3 | 2022-08-10 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Funny Kids Children's Music (Instrumental Music For Kids).mp3 | 2022-08-10 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Cute Background Music for Videos - Cute Little Tikes Kids Song by Happy Face Music.mp3 | 2022-08-10 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | ChuChu TV Classics - Let's Learn The Colors! Nursery Rhymes and Kids Songs.mp3 | 2022-08-10 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Bath Song 2 + More ChuChu TV Baby Nursery Rhymes & Kids Songs.mp3 | 2022-08-10 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | ChuChu TV Classics - Head Shoulders Knees & Toes Dance Song Nursery Rhymes and Kids Songs.mp3 | 2022-08-10 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | Soft Relaxing Baby Sleep Music Best Bedtime Lullabies For Toddlers Good Night Sweet Dreams.mp3 | 2022-08-10 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | Lullabies For Kids - Sleep Baby Nursery Rhymes and Kids Songs Baby Songs Little Baby Bum.mp3 | 2022-08-10 10:37 | 0 | |
![[SND]](/icons/sound2.gif) | k5Ax.mp3 | 2022-08-10 10:37 | 1.1M | |
![[SND]](/icons/sound2.gif) | DJ-Sikok-Bagi-Duo-Tik-Tok-Remix-Terbaru-2022-DJ-Cantik-Remix_a3cS7dQCKGI.mp3 | 2022-08-10 10:36 | 0 | |
![[SND]](/icons/sound2.gif) | Bath Song 2 - ChuChu TV Nursery Rhymes & Kids Songs.mp3 | 2022-08-10 10:36 | 0 | |
![[SND]](/icons/sound2.gif) | Siti Nurhaliza - Aisyah Istri Rasulullah ( Cover ).mp3 | 2022-08-10 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | SABYAN - AISYAH ISTRI RASULULLAHCOVER.mp3 | 2022-08-10 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | AISYAH ISTRI RASULULLAH - ANISA RAHMAN (Cover).mp3 | 2022-08-10 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | Aisyah Istri Rasulullah (cover by Sheryl Shazwanie).mp3 | 2022-08-10 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | AISYAH ISTRI RASULULLAH - PUTIH ABU ABU COVER.mp3 | 2022-08-10 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | AISYAH ISTRI RASULULLAH COVER BY BABY SHIMA.mp3 | 2022-08-10 10:34 | 0 | |
![[SND]](/icons/sound2.gif) | Aisyah Istri Rasulullah versi Upin Ipin Terbaru 2020.mp3 | 2022-08-10 10:34 | 0 | |
![[SND]](/icons/sound2.gif) | ash.mp3 | 2022-08-10 10:33 | 3.3M | |
![[SND]](/icons/sound2.gif) | Ne3.mp3 | 2022-08-10 10:32 | 0 | |
![[VID]](/icons/movie.gif) | Vp7.mp4 | 2022-08-10 10:21 | 0 | |
![[SND]](/icons/sound2.gif) | Tokyo Drift (Fast & Furious).mp3 | 2022-08-10 10:16 | 564K | |
![[SND]](/icons/sound2.gif) | Dajj.mp3 | 2022-08-10 10:14 | 0 | |
![[SND]](/icons/sound2.gif) | dejj.mp3 | 2022-08-10 10:14 | 0 | |
![[SND]](/icons/sound2.gif) | Manifest.mp3 | 2022-08-10 10:12 | 3.4M | |
![[SND]](/icons/sound2.gif) | Mr. Bill Collector.m4a | 2022-08-10 10:11 | 0 | |
![[SND]](/icons/sound2.gif) | luckydj.mp3 | 2022-08-10 10:09 | 0 | |
![[SND]](/icons/sound2.gif) | MORGENSHTERN, The Limba, NILETTO, Boombl4 - СКОЛЬКО СТОИТ ЛЮБОВЬ.mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | NIGHTMORSS - SECRET.mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | MORGENSHTERN - Домой.mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | Surf Curse - Freaks (Slowed Down).mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | Kordhell - Scopin.mp3 | 2022-08-10 10:05 | 3.9M | |
![[SND]](/icons/sound2.gif) | ЯМАУГЛИ - ТАРАНТИНО.mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | Cyrus312 - Horny nigga detected.mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | Kaito Shoma - konfuz x kaito.mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | Maulana-Ardiansyah-Dermaga-Biru-Live-Ska-Reggae_Og6_0laepzM.mp3 | 2022-08-10 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | DERMAGA-BIRU-Thomas-Arya-Cover-Sasa-Official_eXPdhMDKHFY.mp3 | 2022-08-10 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | Dermaga-Biru-Thomas-Arya-cover-Literasi-60-Detik-by-AA-Kacif_Va1F0ydiHoI.mp3 | 2022-08-10 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | Vikram - Rolex BGM.mp3 | 2022-08-10 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | Get Out Of My Way - KGF 2 ! Remix.mp3 | 2022-08-10 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | Chirakukal-Mulakkuvan(PagalWorld).mp3 | 2022-08-10 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | chekuthan_kalame_poyidam.mp3 | 2022-08-10 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | Kaadhal-En-Kaviye-MassTamilan.dev.mp3 | 2022-08-10 09:59 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Suzume no Tojimari.mp3 | 2022-08-10 09:58 | 0 | |
![[SND]](/icons/sound2.gif) | rafy-glaza-mp3 (1).mp3 | 2022-08-10 09:56 | 0 | |
![[SND]](/icons/sound2.gif) | ENZO MF - BANDO feat. Nateman (Official Music Video).mp3 | 2022-08-10 09:56 | 0 | |
![[SND]](/icons/sound2.gif) | gsuqkxj.mp3 | 2022-08-10 09:54 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.app - បទថ្មីកំពុងល្បីក្នុង Tik tok 🎬🎼 New Songs by Chan Studio 🎬🎶🎞️ (128 kbps).mp3 | 2022-08-10 09:53 | 0 | |
![[SND]](/icons/sound2.gif) | carlruploadmusic1.mp3 | 2022-08-10 09:53 | 0 | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - Thundercat - 'Tron Song'-XYGEEa4Qcis-160k-1660125036692.mp3 | 2022-08-10 09:50 | 0 | |
![[SND]](/icons/sound2.gif) | get.mp3 | 2022-08-10 09:48 | 0 | |
![[SND]](/icons/sound2.gif) | loveann.mp3 | 2022-08-10 09:48 | 0 | |
![[SND]](/icons/sound2.gif) | WSHL.mp3 | 2022-08-10 09:44 | 0 | |
![[SND]](/icons/sound2.gif) | DCM.mp3 | 2022-08-10 09:43 | 0 | |
![[SND]](/icons/sound2.gif) | HAPPY.mp3 | 2022-08-10 09:42 | 3.0M | |
![[SND]](/icons/sound2.gif) | Макс Корж - Малиновый закат.mp3 | 2022-08-10 09:42 | 0 | |
![[SND]](/icons/sound2.gif) | DSAAC.mp3 | 2022-08-10 09:40 | 0 | |
![[SND]](/icons/sound2.gif) | Slava_-_YA_i_ty_52551041.mp3 | 2022-08-10 09:36 | 0 | |
![[SND]](/icons/sound2.gif) | SION Rework Voce Italiana -SION Rework Voice ITA 2014 (mp3cut.net).m4a | 2022-08-10 09:36 | 0 | |
![[SND]](/icons/sound2.gif) | mp50.mp3 | 2022-08-10 09:34 | 0 | |
![[SND]](/icons/sound2.gif) | ken.mp3 | 2022-08-10 09:34 | 0 | |
![[SND]](/icons/sound2.gif) | Troye.m4a | 2022-08-10 09:31 | 0 | |
![[SND]](/icons/sound2.gif) | SUPIAR OTO - D'ROC'K (Official Music Video) (1).mp3 | 2022-08-10 09:29 | 0 | |
![[SND]](/icons/sound2.gif) | seboy.mp3 | 2022-08-10 09:26 | 0 | |
![[SND]](/icons/sound2.gif) | TUT.mp3 | 2022-08-10 09:26 | 0 | |
![[SND]](/icons/sound2.gif) | KAS.mp3 | 2022-08-10 09:25 | 0 | |
![[SND]](/icons/sound2.gif) | anime.mp3 | 2022-08-10 09:25 | 0 | |
![[SND]](/icons/sound2.gif) | ASK.mp3 | 2022-08-10 09:25 | 2.9M | |
![[SND]](/icons/sound2.gif) | REMIX1.mp3 | 2022-08-10 09:25 | 3.2M | |
![[SND]](/icons/sound2.gif) | Geometry Dash - SLAUGHTERHOUSE_(MP3Ball.ru).mp3 | 2022-08-10 09:23 | 0 | |
![[SND]](/icons/sound2.gif) | MORGENSHTERN, Элджей - Cadillac.mp3 | 2022-08-10 09:23 | 6.8M | |
![[SND]](/icons/sound2.gif) | Molchat_Doma_-_Na_dne_58595703.mp3 | 2022-08-10 09:22 | 0 | |
![[SND]](/icons/sound2.gif) | Mil.mp3 | 2022-08-10 09:20 | 0 | |
![[SND]](/icons/sound2.gif) | inginusai.mp3 | 2022-08-10 09:19 | 0 | |
![[SND]](/icons/sound2.gif) | morgenshtern-feat-eldzhey-cadillac.mp3 | 2022-08-10 09:15 | 0 | |
![[SND]](/icons/sound2.gif) | dgt12.mp3 | 2022-08-10 09:15 | 0 | |
![[SND]](/icons/sound2.gif) | Bakit.mp3 | 2022-08-10 09:15 | 0 | |
![[SND]](/icons/sound2.gif) | какашка pou - игры для всей семьи (1).mp3 | 2022-08-10 09:14 | 0 | |
![[SND]](/icons/sound2.gif) | zm1.mp3 | 2022-08-10 09:12 | 44K | |
![[SND]](/icons/sound2.gif) | 11678.mp3 | 2022-08-10 09:09 | 0 | |
![[SND]](/icons/sound2.gif) | Bugoy.mp3 | 2022-08-10 09:07 | 2.7M | |
![[SND]](/icons/sound2.gif) | jakone_-_kurit__(feat._a.v.g__itachi)_muzati.net.mp3 | 2022-08-10 09:06 | 0 | |
![[SND]](/icons/sound2.gif) | Panda.mp3 | 2022-08-10 09:01 | 1.9M | |
![[SND]](/icons/sound2.gif) | NOBITA - IKAW LANG _ Official Lyric Video.mp3 | 2022-08-10 08:53 | 4.0M | |
![[SND]](/icons/sound2.gif) | Because - Marlboro Black.mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Al James - Pahinga (Official Audio).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Pagsamo - Arthur Nery (Official Music Video).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Al James - Pa-umaga.mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | December Avenue - Huling Sandali (OFFICIAL LYRIC VIDEO).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Munimuni - Bawat Piyesa (Official Lyric Video).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Adie - Paraluman (Official Audio).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | 727 Clique - Family Day.mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Joji - Sanctuary (Official Video).mp3 | 2022-08-10 08:53 | 2.9M | |
![[SND]](/icons/sound2.gif) | Joji - SLOW DANCING IN THE DARK.mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Munimuni - Sa Hindi Pag-alala (Lyric Video).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | PARASITIKO - Jrldm ft. Lexus (Official Music Video).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Akala Mo Ata (OMV) - Nateman x Realest Cram x CK YG (Dir. by Lua Swish).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Akala Mo Ata (feat. Nateman, Realest Cram & CK YG).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Paraluman sad version.mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | UNIQUE - Sino (Official Music Video).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Fenn7.mp3 | 2022-08-10 08:52 | 0 | |
![[SND]](/icons/sound2.gif) | lambi-judai.mp3 | 2022-08-10 08:45 | 0 | |
![[SND]](/icons/sound2.gif) | kewer1.mp3 | 2022-08-10 08:45 | 0 | |
![[SND]](/icons/sound2.gif) | zara-sa.mp3 | 2022-08-10 08:40 | 0 | |
![[SND]](/icons/sound2.gif) | AA.mp3 | 2022-08-10 08:38 | 80K | |
![[SND]](/icons/sound2.gif) | s.mp3 | 2022-08-10 08:36 | 0 | |
![[SND]](/icons/sound2.gif) | Rex Orange County - THE SHADE (Official Audio).mp3 | 2022-08-10 08:32 | 0 | |
![[SND]](/icons/sound2.gif) | Fenn9Athecraz1.mp3 | 2022-08-10 08:31 | 2.8M | |
![[SND]](/icons/sound2.gif) | djj1.mp3 | 2022-08-10 08:17 | 3.3M | |
![[SND]](/icons/sound2.gif) | Zhu Ni Shengri Kuai Le- Happy Birthday Mandarin Chinese Kid Song Lyrics.mp3 | 2022-08-10 08:17 | 0 | |
![[SND]](/icons/sound2.gif) | dj4.mp3 | 2022-08-10 08:16 | 480K | |
![[SND]](/icons/sound2.gif) | A.L.A - Piano (feat. Didine Canon 16).mp3 | 2022-08-10 08:08 | 0 | |
![[SND]](/icons/sound2.gif) | NAAN JACKSON.mp3 | 2022-08-10 08:07 | 0 | |
![[SND]](/icons/sound2.gif) | Made3.mp3 | 2022-08-10 08:07 | 0 | |
![[SND]](/icons/sound2.gif) | Made2.mp3 | 2022-08-10 08:07 | 0 | |
![[SND]](/icons/sound2.gif) | Made1.mp3 | 2022-08-10 08:07 | 0 | |
![[SND]](/icons/sound2.gif) | OPPANA SONG,.mp3 | 2022-08-10 08:04 | 0 | |
![[SND]](/icons/sound2.gif) | POORAM KANAN DJ.mp3 | 2022-08-10 08:03 | 0 | |
![[SND]](/icons/sound2.gif) | y2meta.com - VIET DEEP 2022 - HOUSE LAK CHILL ĐI BẠN ƠI, VIỆT MIX 2022 - SET NHẠC CHILL (128 kbps).mp3 | 2022-08-10 08:02 | 44K | |
![[SND]](/icons/sound2.gif) | Fennfenn1.mp3 | 2022-08-10 08:02 | 0 | |
![[SND]](/icons/sound2.gif) | FennFenn1.mp3 | 2022-08-10 08:00 | 0 | |
![[SND]](/icons/sound2.gif) | Seafret - Atlantis (Lyrics).mp3 | 2022-08-10 07:59 | 0 | |
![[SND]](/icons/sound2.gif) | sulthan.mp3 | 2022-08-10 07:59 | 0 | |
![[SND]](/icons/sound2.gif) | SHA.mp3 | 2022-08-10 07:59 | 0 | |
![[SND]](/icons/sound2.gif) | Ezra6.mp3 | 2022-08-10 07:59 | 0 | |
![[SND]](/icons/sound2.gif) | Los.mp3 | 2022-08-10 07:58 | 0 | |
![[SND]](/icons/sound2.gif) | Ed Sheeran - Photograph (Official Music Video).mp3 | 2022-08-10 07:57 | 0 | |
![[SND]](/icons/sound2.gif) | sulthan 1.mp3 | 2022-08-10 07:56 | 0 | |
![[SND]](/icons/sound2.gif) | Vel.mp3 | 2022-08-10 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | Nicky Youre, dazy - Sunroof (Official Music Video).mp3 | 2022-08-10 07:52 | 2.7M | |
![[SND]](/icons/sound2.gif) | Kewer.mp3 | 2022-08-10 07:49 | 0 | |
![[SND]](/icons/sound2.gif) | a505.mp3 | 2022-08-10 07:47 | 0 | |
![[SND]](/icons/sound2.gif) | SARJANA.mp3 | 2022-08-10 07:39 | 0 | |
![[SND]](/icons/sound2.gif) | ligaw.mp3 | 2022-08-10 07:39 | 104K | |
![[SND]](/icons/sound2.gif) | DjFenn1.mp3 | 2022-08-10 07:39 | 1.1M | |
![[SND]](/icons/sound2.gif) | DjFenn2.mp3 | 2022-08-10 07:38 | 3.0M | |
![[SND]](/icons/sound2.gif) | hohey.mp3 | 2022-08-10 07:29 | 140K | |
![[SND]](/icons/sound2.gif) | glassanimals.mp3 | 2022-08-10 07:29 | 0 | |
![[SND]](/icons/sound2.gif) | djthailand.mp3 | 2022-08-10 07:29 | 0 | |
![[SND]](/icons/sound2.gif) | Zexx.mp3 | 2022-08-10 07:29 | 1.2M | |
![[SND]](/icons/sound2.gif) | middle of night.mp3 | 2022-08-10 07:29 | 2.8M | |
![[SND]](/icons/sound2.gif) | man.mp3 | 2022-08-10 07:28 | 4.2M | |
![[SND]](/icons/sound2.gif) | Bentot.mp3 | 2022-08-10 07:27 | 0 | |
![[SND]](/icons/sound2.gif) | ZX.mp3 | 2022-08-10 07:26 | 0 | |
![[SND]](/icons/sound2.gif) | badcurt-kert-ya-tebya-lyublyu-mp3.mp3 | 2022-08-10 07:26 | 0 | |
![[SND]](/icons/sound2.gif) | typeluv-poslan.mp3 | 2022-08-10 07:24 | 0 | |
![[SND]](/icons/sound2.gif) | Marikit.mp3 | 2022-08-10 07:00 | 0 | |
![[SND]](/icons/sound2.gif) | sad3.mp3 | 2022-08-10 06:52 | 160K | |
![[SND]](/icons/sound2.gif) | Baak_Gmlcineliolu_-_Bir_Anda_73825968.mp3 | 2022-08-10 06:49 | 0 | |
![[SND]](/icons/sound2.gif) | blls3.mp3 | 2022-08-10 06:39 | 0 | |
![[SND]](/icons/sound2.gif) | :)).mp3 | 2022-08-10 06:30 | 0 | |
![[SND]](/icons/sound2.gif) | Troye.mp3 | 2022-08-10 06:29 | 3.1M | |
![[SND]](/icons/sound2.gif) | Xcho_Mr_Lambo_-_Zakryla_dal_74291179.mp3 | 2022-08-10 06:27 | 0 | |
![[SND]](/icons/sound2.gif) | tonggiavy.mp3 | 2022-08-10 06:27 | 0 | |
![[SND]](/icons/sound2.gif) | MOLLBEN37.mp3 | 2022-08-10 06:16 | 2.8M | |
![[SND]](/icons/sound2.gif) | itoangliga.mp3 | 2022-08-10 06:11 | 3.2M | |
![[SND]](/icons/sound2.gif) | euphoria.mp3 | 2022-08-10 06:10 | 0 | |
![[SND]](/icons/sound2.gif) | Demeter_Discoteka.mp3 | 2022-08-10 06:02 | 0 | |
![[SND]](/icons/sound2.gif) | RAIKAHO - Психопат.mp3 | 2022-08-10 06:01 | 0 | |
![[SND]](/icons/sound2.gif) | HTRCP1.mp3 | 2022-08-10 06:00 | 0 | |
![[SND]](/icons/sound2.gif) | dhhje.mp3 | 2022-08-10 05:59 | 0 | |
![[SND]](/icons/sound2.gif) | Instrumen Sedih, Instrumen Musik paling Sedih, Instrumen Sedih Bikin Nangis.mp3 | 2022-08-10 05:59 | 0 | |
![[SND]](/icons/sound2.gif) | bsata.mp3 | 2022-08-10 05:57 | 0 | |
![[SND]](/icons/sound2.gif) | pasaway.mp3 | 2022-08-10 05:57 | 0 | |
![[SND]](/icons/sound2.gif) | PSYCHEDELIC BOYZ - RAWSTARR TIL I DIE (BATANG PASAWAY)_160k.mp3 | 2022-08-10 05:55 | 0 | |
![[SND]](/icons/sound2.gif) | Rawr8.mp3 | 2022-08-10 05:55 | 0 | |
![[SND]](/icons/sound2.gif) | Tekiteki.mp3 | 2022-08-10 05:54 | 0 | |
![[SND]](/icons/sound2.gif) | mabagal.mp3 | 2022-08-10 05:54 | 0 | |
![[SND]](/icons/sound2.gif) | munimuni.mp3 | 2022-08-10 05:54 | 0 | |
![[SND]](/icons/sound2.gif) | Lily of The Valley.mp3 | 2022-08-10 05:53 | 328K | |
![[SND]](/icons/sound2.gif) | papel.mp3 | 2022-08-10 05:53 | 5.8M | |
![[SND]](/icons/sound2.gif) | xinmaruocdau.mp3 | 2022-08-10 05:52 | 0 | |
![[SND]](/icons/sound2.gif) | kadhal.mp3 | 2022-08-10 05:52 | 0 | |
![[SND]](/icons/sound2.gif) | Kannil.mp3 | 2022-08-10 05:51 | 0 | |
![[SND]](/icons/sound2.gif) | Rabbane.mp3 | 2022-08-10 05:51 | 0 | |
![[SND]](/icons/sound2.gif) | Lilyofthevalley.m4a | 2022-08-10 05:49 | 0 | |
![[SND]](/icons/sound2.gif) | ghbd.mp3 | 2022-08-10 05:41 | 2.9M | |
![[SND]](/icons/sound2.gif) | bg.mp3 | 2022-08-10 05:39 | 8.2M | |
![[SND]](/icons/sound2.gif) | AleksMarty_Corrosive.mp3 | 2022-08-10 05:38 | 2.2M | |
![[SND]](/icons/sound2.gif) | Za.mp3 | 2022-08-10 05:38 | 4.0M | |
![[SND]](/icons/sound2.gif) | botsurpdj12.mp3 | 2022-08-10 05:38 | 0 | |
![[SND]](/icons/sound2.gif) | FERDZ X ELLA EYS X PACHO - SUNDO (COSA NOSTRA I OST).mp3 | 2022-08-10 05:37 | 0 | |
![[SND]](/icons/sound2.gif) | Tetap Dalam Jiwa.mp3 | 2022-08-10 05:32 | 0 | |
![[SND]](/icons/sound2.gif) | WENAKK.mp3 | 2022-08-10 05:30 | 0 | |
![[SND]](/icons/sound2.gif) | Audioghh.mp3 | 2022-08-10 05:27 | 0 | |
![[SND]](/icons/sound2.gif) | ferdzapelyido.mp3 | 2022-08-10 05:22 | 0 | |
![[SND]](/icons/sound2.gif) | requestferdz.mp3 | 2022-08-10 05:21 | 0 | |
![[SND]](/icons/sound2.gif) | mr7.mp3 | 2022-08-10 05:20 | 3.3M | |
![[SND]](/icons/sound2.gif) | gk tau.mp3 | 2022-08-10 05:20 | 0 | |
![[SND]](/icons/sound2.gif) | za.mp3 | 2022-08-10 05:19 | 0 | |
![[SND]](/icons/sound2.gif) | fmhdlg.mp3 | 2022-08-10 05:19 | 3.2M | |
![[SND]](/icons/sound2.gif) | DJ ENAKEUNN V4 X MAMA BALE BALE VINKY YT VIRAL TIK TOK TERBARU 2022 YANG KALIAN CARI !.mp3 | 2022-08-10 05:16 | 0 | |
![[SND]](/icons/sound2.gif) | mr5.mp3 | 2022-08-10 05:16 | 3.2M | |
![[SND]](/icons/sound2.gif) | frdz.mp3 | 2022-08-10 05:14 | 756K | |
![[SND]](/icons/sound2.gif) | mr4.mp3 | 2022-08-10 05:12 | 3.1M | |
![[SND]](/icons/sound2.gif) | mr3.mp3 | 2022-08-10 05:07 | 2.8M | |
![[SND]](/icons/sound2.gif) | mr2.mp3 | 2022-08-10 05:02 | 2.7M | |
![[SND]](/icons/sound2.gif) | joby101.mp3 | 2022-08-10 04:56 | 892K | |
![[SND]](/icons/sound2.gif) | Jeydii.mp3 | 2022-08-10 04:55 | 752K | |
![[SND]](/icons/sound2.gif) | mr1.mp3 | 2022-08-10 04:54 | 4.6M | |
![[SND]](/icons/sound2.gif) | ulap.mp3 | 2022-08-10 04:52 | 0 | |
![[SND]](/icons/sound2.gif) | yellow.mp3 | 2022-08-10 04:52 | 3.2M | |
![[SND]](/icons/sound2.gif) | bmw.mp3 | 2022-08-10 04:51 | 0 | |
![[SND]](/icons/sound2.gif) | pano.mp3 | 2022-08-10 04:51 | 3.9M | |
![[SND]](/icons/sound2.gif) | sanctuary.mp3 | 2022-08-10 04:50 | 2.8M | |
![[SND]](/icons/sound2.gif) | somebody.mp3 | 2022-08-10 04:50 | 2.2M | |
![[SND]](/icons/sound2.gif) | pasko.mp3 | 2022-08-10 04:43 | 0 | |
![[SND]](/icons/sound2.gif) | Bahanapui.mp3 | 2022-08-10 04:40 | 0 | |
![[SND]](/icons/sound2.gif) | sjdajd.mp3.mp3 | 2022-08-10 04:38 | 0 | |
![[SND]](/icons/sound2.gif) | Cf.mp3 | 2022-08-10 04:32 | 0 | |
![[SND]](/icons/sound2.gif) | SAO.mp3 | 2022-08-10 04:28 | 0 | |
![[SND]](/icons/sound2.gif) | Seinpogi.mp3 | 2022-08-10 04:22 | 0 | |
![[SND]](/icons/sound2.gif) | Wanna.mp3 | 2022-08-10 04:21 | 3.1M | |
![[SND]](/icons/sound2.gif) | y2mate.com - The Walters I Love You So_320kbps.mp3 | 2022-08-10 04:18 | 0 | |
![[SND]](/icons/sound2.gif) | Callip12.mp3 | 2022-08-10 04:17 | 0 | |
![[SND]](/icons/sound2.gif) | MannyManny.mp3 | 2022-08-10 04:10 | 0 | |
![[SND]](/icons/sound2.gif) | music2.mp3 | 2022-08-10 04:08 | 108K | |
![[SND]](/icons/sound2.gif) | GASAGA.mp3 | 2022-08-10 04:07 | 348K | |
![[SND]](/icons/sound2.gif) | jolen.mp3 | 2022-08-10 04:06 | 661K | |
![[SND]](/icons/sound2.gif) | Suzume-no-Tojimari-Trailer-2-SONG-Suzume-Nanoka-Hara-Lyrics-KAN-ROM-ENG_RO2mt82300Q.mp3 | 2022-08-10 03:59 | 0 | |
![[SND]](/icons/sound2.gif) | music1.mp3 | 2022-08-10 03:57 | 3.8M | |
![[SND]](/icons/sound2.gif) | Kiyo x Because - Ano na [Slow remix] PROD. SHORTONE.mp3 | 2022-08-10 03:55 | 0 | |
![[SND]](/icons/sound2.gif) | Shanti Dope - Nadarang (Official Music Video).mp3 | 2022-08-10 03:50 | 0 | |
![[SND]](/icons/sound2.gif) | Lo ki - Munting Paraiso (Lyrics).mp3 | 2022-08-10 03:50 | 0 | |
![[SND]](/icons/sound2.gif) | Lo Ki - Kagome (Official Music Video).mp3 | 2022-08-10 03:50 | 3.7M | |
![[SND]](/icons/sound2.gif) | VAR.mp3 | 2022-08-10 03:49 | 0 | |
![[SND]](/icons/sound2.gif) | Dre Dog - Smoke Dope and Rap.mp3 | 2022-08-10 03:46 | 0 | |
![[SND]](/icons/sound2.gif) | TEN1.mp3 | 2022-08-10 03:38 | 0 | |
![[SND]](/icons/sound2.gif) | bla.mp3 | 2022-08-10 03:36 | 0 | |
![[SND]](/icons/sound2.gif) | pln.mp3 | 2022-08-10 03:32 | 1.6M | |
![[SND]](/icons/sound2.gif) | IMG_1243.MOV.mp3 | 2022-08-10 03:27 | 0 | |
![[SND]](/icons/sound2.gif) | Hiling.mp3 | 2022-08-10 03:22 | 4.5M | |
![[SND]](/icons/sound2.gif) | AUD-20220605-WA0046.mp3 | 2022-08-10 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | AUD-20220314-WA0050.m4a | 2022-08-10 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | remix.mp3 | 2022-08-10 03:19 | 2.4M | |
![[SND]](/icons/sound2.gif) | АСТМА 3..mp3 | 2022-08-10 03:18 | 0 | |
![[SND]](/icons/sound2.gif) | Line.mp3 | 2022-08-10 03:15 | 3.8M | |
![[SND]](/icons/sound2.gif) | Lambi Judai 128 Kbps.mp3 | 2022-08-10 03:15 | 0 | |
![[SND]](/icons/sound2.gif) | Zara Sa.mp3 | 2022-08-10 03:11 | 0 | |
![[SND]](/icons/sound2.gif) | JhoNT2.mp3 | 2022-08-10 03:04 | 0 | |
![[VID]](/icons/movie.gif) | Better Call Saul - Chuck loses control.mp4 | 2022-08-10 03:01 | 0 | |
![[SND]](/icons/sound2.gif) | Cheriimoya_feat._Sierra_Kidd_feat._55_-_living_life_in_the_night_(Gybka.com).mp3 | 2022-08-10 02:51 | 0 | |
![[SND]](/icons/sound2.gif) | TAKBO.mp3 | 2022-08-10 02:51 | 0 | |
![[SND]](/icons/sound2.gif) | Zachem_mne_solnce_v_Monako_polnaya_versiya_-_Pesnya_73364115.mp3 | 2022-08-10 02:51 | 0 | |
![[SND]](/icons/sound2.gif) | LoOk aT aLL tHoSe ElVeS.mp3 | 2022-08-10 02:47 | 0 | |
![[SND]](/icons/sound2.gif) | Lil_Nas_X_-_Panini_Official_Video.mp3 | 2022-08-10 02:40 | 0 | |
![[SND]](/icons/sound2.gif) | Man Screaming CEEDAY Sound Effect HD.mp3 | 2022-08-10 02:38 | 0 | |
![[SND]](/icons/sound2.gif) | CaWa - Balenciaga (www.hotplayer.ru).mp3 | 2022-08-10 02:38 | 0 | |
![[SND]](/icons/sound2.gif) | mp3-now.com - Mick Gordon The Only Thing They Fear Is You DOOM Eternal OST High Quality 2020.mp3 | 2022-08-10 02:38 | 0 | |
![[SND]](/icons/sound2.gif) | Home_With_Hope.mp3 | 2022-08-10 02:36 | 0 | |
![[SND]](/icons/sound2.gif) | dj.mp3 | 2022-08-10 02:34 | 0 | |
![[SND]](/icons/sound2.gif) | The Only Thing They Fear Is You ( DOOM Eternal OST High Quality 2021 MICK GORDON).mp3 | 2022-08-10 02:34 | 0 | |
![[SND]](/icons/sound2.gif) | dj8.mp3 | 2022-08-10 02:30 | 504K | |
![[SND]](/icons/sound2.gif) | 8mb.video-n8U-RPTnuLjT.mp3 | 2022-08-10 02:30 | 0 | |
![[SND]](/icons/sound2.gif) | RTX.mp3 | 2022-08-10 02:27 | 0 | |
![[SND]](/icons/sound2.gif) | RdV1.mp3 | 2022-08-10 02:27 | 4.0M | |
![[SND]](/icons/sound2.gif) | WhatsApp Audio 2022-08-09 at 3.22.21 PM.mp3 | 2022-08-10 02:26 | 0 | |
![[SND]](/icons/sound2.gif) | TLT.mp3 | 2022-08-10 02:25 | 0 | |
![[SND]](/icons/sound2.gif) | behind_the_chimney_DEMO_29-5-22_2-1.mp3 | 2022-08-10 02:23 | 0 | |
![[SND]](/icons/sound2.gif) | WhatsApp Audio 2022-08-10 at 09.17.47.mp3 | 2022-08-10 02:19 | 0 | |
![[SND]](/icons/sound2.gif) | CHOP.mp3 | 2022-08-10 02:17 | 0 | |
![[SND]](/icons/sound2.gif) | ajpanalo.mp3 | 2022-08-10 02:17 | 0 | |
![[SND]](/icons/sound2.gif) | dj7.mp3 | 2022-08-10 02:15 | 504K | |
![[SND]](/icons/sound2.gif) | dj5.mp3 | 2022-08-10 02:15 | 424K | |
![[SND]](/icons/sound2.gif) | DAK.mp3 | 2022-08-10 02:15 | 4.2M | |
![[SND]](/icons/sound2.gif) | Aisyah.mp3 | 2022-08-10 02:13 | 3.6M | |
![[SND]](/icons/sound2.gif) | intropanalo.mp3 | 2022-08-10 02:13 | 0 | |
![[SND]](/icons/sound2.gif) | Turu.mp3 | 2022-08-10 02:12 | 732K | |
![[SND]](/icons/sound2.gif) | Jopay.mp3 | 2022-08-10 02:11 | 4.1M | |
![[SND]](/icons/sound2.gif) | mp7.mp3 | 2022-08-10 02:04 | 4.3M | |
![[SND]](/icons/sound2.gif) | Hmmm.mp3 | 2022-08-10 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | Sadboy.mp3 | 2022-08-10 01:41 | 1.1M | |
![[SND]](/icons/sound2.gif) | ecan.mp3 | 2022-08-10 01:38 | 0 | |
![[SND]](/icons/sound2.gif) | thangcam.mp3 | 2022-08-10 01:33 | 0 | |
![[SND]](/icons/sound2.gif) | Staring at Stars.mp3 | 2022-08-10 01:33 | 0 | |
![[VID]](/icons/movie.gif) | Tastelike Cake - Starring at stars ( Dream Piano Song ).mp4 | 2022-08-10 01:30 | 0 | |
![[SND]](/icons/sound2.gif) | Rn17.mp3 | 2022-08-10 01:27 | 0 | |
![[SND]](/icons/sound2.gif) | inbound833631831458767416.mp3 | 2022-08-10 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | poyuya.mp3 | 2022-08-10 01:23 | 0 | |
![[SND]](/icons/sound2.gif) | ngoisaocodon.mp3 | 2022-08-10 01:21 | 0 | |
![[SND]](/icons/sound2.gif) | mp2.mp3 | 2022-08-10 01:20 | 3.0M | |
![[SND]](/icons/sound2.gif) | bensound-buddy.mp3 | 2022-08-10 01:17 | 0 | |
![[SND]](/icons/sound2.gif) | Musik.mp3 | 2022-08-10 01:15 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - ささえる人の歌 back number.mp3 | 2022-08-10 01:14 | 0 | |
![[SND]](/icons/sound2.gif) | unwell.mp3 | 2022-08-10 01:13 | 0 | |
![[SND]](/icons/sound2.gif) | 1575866702_korol_i_shut_vospominaniya_o_byloy_lyubvi.mp3 | 2022-08-10 01:11 | 0 | |
![[SND]](/icons/sound2.gif) | SAFESAFE.mp3 | 2022-08-10 01:06 | 0 | |
![[SND]](/icons/sound2.gif) | Central Cee Doja Directed by Cole Bennett_2.mp3 | 2022-08-10 01:05 | 0 | |
![[SND]](/icons/sound2.gif) | Tokyo Drift - Teriyaki Boyz [ MUSIC VIDEO ] HD.mp3 | 2022-08-10 01:03 | 3.9M | |
![[SND]](/icons/sound2.gif) | Daun Jatuh - Resah Jadi Luka (Official Audio).mp3 | 2022-08-10 01:03 | 0 | |
![[SND]](/icons/sound2.gif) | seandainya - vierra (slowed reverb lyrics).mp3 | 2022-08-10 01:03 | 0 | |
![[SND]](/icons/sound2.gif) | LAST CHILD - BERNAFAS TANPAMU (Lirik Lyric).mp3 | 2022-08-10 01:03 | 0 | |
![[SND]](/icons/sound2.gif) | Covidv.mp3 | 2022-08-10 01:02 | 0 | |
![[SND]](/icons/sound2.gif) | covidvibes.mp3 | 2022-08-10 01:00 | 0 | |
![[SND]](/icons/sound2.gif) | hey_loser_you_scared_yes.mp3 | 2022-08-10 00:49 | 0 | |
![[VID]](/icons/movie.gif) | VID_20220810015523.mp4 | 2022-08-10 00:41 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Story Wa Anime AOT Lagu Sasageyo.mp3 | 2022-08-10 00:24 | 0 | |
![[SND]](/icons/sound2.gif) | Vyacheslav Mescherin Orchestra - Frogs.mp3 | 2022-08-10 00:13 | 0 | |
![[SND]](/icons/sound2.gif) | AUD-20220804-WA0000.mp3 | 2022-08-09 23:57 | 0 | |
![[SND]](/icons/sound2.gif) | Al_Bakara.mp3 | 2022-08-09 23:55 | 0 | |
![[SND]](/icons/sound2.gif) | Sura_2_Al-Bakara_Korova_-_Korana_na_arabskom_s_perevodom_na_russkij_yazyk._(iPleer.com).mp3 | 2022-08-09 23:51 | 0 | |
![[SND]](/icons/sound2.gif) | Fireboy_DML_ft_Asake_-_Bandana_AstroBaze.com.mp3 | 2022-08-09 23:32 | 0 | |
![[SND]](/icons/sound2.gif) | Fireboy_DML_-_Change_AstroBaze.com.mp3 | 2022-08-09 23:30 | 0 | |
![[SND]](/icons/sound2.gif) | vp11.mp3 | 2022-08-09 23:28 | 0 | |
![[SND]](/icons/sound2.gif) | kanjut.mp3 | 2022-08-09 23:25 | 0 | |
![[VID]](/icons/movie.gif) | Vp1.mp4 | 2022-08-09 23:13 | 0 | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - Indila - Tourner Dans Le Vide-vtNJMAyeP0s-160k-1660086324721.mp3 | 2022-08-09 23:06 | 0 | |
![[SND]](/icons/sound2.gif) | vs3.mp3 | 2022-08-09 22:55 | 0 | |
![[SND]](/icons/sound2.gif) | vs2.mp3 | 2022-08-09 22:54 | 0 | |
![[SND]](/icons/sound2.gif) | vs1.mp3 | 2022-08-09 22:54 | 0 | |
![[SND]](/icons/sound2.gif) | Юлия_Савичева_Не_смотри_PHONK_EDITION_BY_KINEZIS.mp3 | 2022-08-09 22:53 | 1.2M | |
![[SND]](/icons/sound2.gif) | one direction - strong.mp3 | 2022-08-09 22:42 | 0 | |
![[SND]](/icons/sound2.gif) | قراءة منظومة الزمزمي_ _للقارئ علي صلاح عمر_ مركز تكوين المفسر.mp3 | 2022-08-09 22:29 | 0 | |
![[VID]](/icons/movie.gif) | carlos-vives-ft-shakira-la-bicicleta-by-elin-manny-ens-letra_smnQolF2.mp4 | 2022-08-09 22:19 | 0 | |
![[SND]](/icons/sound2.gif) | tian1.mp3 | 2022-08-09 22:12 | 0 | |
![[SND]](/icons/sound2.gif) | teste.mp3 | 2022-08-09 22:12 | 44K | |
![[SND]](/icons/sound2.gif) | Sc3.mp3 | 2022-08-09 22:10 | 2.7M | |
![[SND]](/icons/sound2.gif) | Derya Uluğ - Kanunlar Gibi (Mert Kurt Remix).mp3 | 2022-08-09 22:05 | 0 | |
![[VID]](/icons/movie.gif) | carlos-vives-ft-shakira-la-bicicleta-by-elin-manny-ens-letra_MwoYl7Yg.mp4 | 2022-08-09 22:03 | 0 | |
![[SND]](/icons/sound2.gif) | toro1.mp3 | 2022-08-09 21:55 | 4.1M | |
![[SND]](/icons/sound2.gif) | OVERTIME ROUGH DRAFT (working on).mp3 | 2022-08-09 21:53 | 4.7M | |
![[SND]](/icons/sound2.gif) | Rainy Day yes vocals first mix (online-audio-converter.com)(2).mp3 | 2022-08-09 21:50 | 0 | |
![[SND]](/icons/sound2.gif) | Neck_Deep_-_December(128k).mp3 | 2022-08-09 21:48 | 0 | |
![[SND]](/icons/sound2.gif) | logingnlrp.mp3 | 2022-08-09 21:48 | 0 | |
![[SND]](/icons/sound2.gif) | IShowSpeed - Shake (Official Music Video).mp3 | 2022-08-09 21:44 | 0 | |
![[SND]](/icons/sound2.gif) | one-shot-a-la-conquete_456239046.mp3 | 2022-08-09 21:44 | 0 | |
![[SND]](/icons/sound2.gif) | loginlrp.m4a | 2022-08-09 21:42 | 420K | |
![[SND]](/icons/sound2.gif) | Adur.mp3 | 2022-08-09 21:42 | 2.2M | |
![[SND]](/icons/sound2.gif) | Grey.mp3 | 2022-08-09 21:39 | 2.9M | |
![[SND]](/icons/sound2.gif) | Самурай.mp3 | 2022-08-09 21:25 | 0 | |
![[SND]](/icons/sound2.gif) | mp3-now.com - Eminem Dr Dre 50 Cent Crack A Bottle Official Video.mp3 | 2022-08-09 21:25 | 0 | |
![[SND]](/icons/sound2.gif) | CALLX_9-8-2022_21-49-21_01096076324.mp3 | 2022-08-09 21:25 | 0 | |
![[SND]](/icons/sound2.gif) | INSTASAMKA_-_moneyken-love.mp3 | 2022-08-09 21:18 | 0 | |
![[SND]](/icons/sound2.gif) | Scally_Milano_163ONMYNECK_-_Swag_73511571.mp3 | 2022-08-09 21:16 | 0 | |
![[SND]](/icons/sound2.gif) | wshr1.mp3 | 2022-08-09 21:05 | 0 | |
![[SND]](/icons/sound2.gif) | ER3.mp3 | 2022-08-09 21:04 | 0 | |
![[SND]](/icons/sound2.gif) | ER2.mp3 | 2022-08-09 21:03 | 0 | |
![[SND]](/icons/sound2.gif) | Myusl_-_Kurwa_Bobr_74481210.mp3 | 2022-08-09 20:55 | 0 | |
![[SND]](/icons/sound2.gif) | oo.mp3 | 2022-08-09 20:51 | 1.7M | |
![[SND]](/icons/sound2.gif) | BB8.mp3 | 2022-08-09 20:51 | 0 | |
![[SND]](/icons/sound2.gif) | [YT2mp3.info] - Arctic Monkeys - Do I Wanna Know_ (Official Video) (320kbps).mp3 | 2022-08-09 20:42 | 0 | |
![[SND]](/icons/sound2.gif) | Sting_money_Audio_425507.mp3 | 2022-08-09 20:35 | 0 | |
![[SND]](/icons/sound2.gif) | Batu2.mp3 | 2022-08-09 20:32 | 0 | |
![[SND]](/icons/sound2.gif) | Batu1.mp3 | 2022-08-09 20:32 | 8.0M | |
![[SND]](/icons/sound2.gif) | ii.mp3 | 2022-08-09 20:22 | 4.5M | |
![[SND]](/icons/sound2.gif) | MyBandaMiyagi.mp3 | 2022-08-09 20:11 | 3.7M | |
![[SND]](/icons/sound2.gif) | SANTUY.mp3 | 2022-08-09 20:10 | 2.7M | |
![[SND]](/icons/sound2.gif) | Selamat Pagi Dunia Tipu Tipu.mp3 | 2022-08-09 20:09 | 0 | |
![[SND]](/icons/sound2.gif) | DeadList1.mp3 | 2022-08-09 20:08 | 0 | |
![[SND]](/icons/sound2.gif) | DvLidhouse.mp3 | 2022-08-09 20:06 | 0 | |
![[SND]](/icons/sound2.gif) | DJ GO SAMPE BAWAH OMO KUCRUT VIRAL TIK TOK TERBARU 2022 YANG KALIAN CARI .mp3 | 2022-08-09 20:03 | 0 | |
![[SND]](/icons/sound2.gif) | NangDumatingKa.mp3 | 2022-08-09 20:03 | 0 | |
![[SND]](/icons/sound2.gif) | MiyaGi_My_Banda_[www.UZmir.net].mp3 | 2022-08-09 20:01 | 0 | |
![[SND]](/icons/sound2.gif) | DDTrack.mp3 | 2022-08-09 19:58 | 0 | |
![[SND]](/icons/sound2.gif) | Nang Dumating Ka - Bandang Lapis (Official Lyric Video).mp3 | 2022-08-09 19:57 | 0 | |
![[SND]](/icons/sound2.gif) | MiyaGi & Эндшпиль & МанТана - Моя Банда [www.UZmir.net].mp3 | 2022-08-09 19:55 | 0 | |
![[SND]](/icons/sound2.gif) | ENIGMA - CAMRY 3.5 (slow remix) (www.hotplayer.ru).mp3 | 2022-08-09 19:51 | 0 | |
![[SND]](/icons/sound2.gif) | NDMK.mp3 | 2022-08-09 19:47 | 0 | |
![[SND]](/icons/sound2.gif) | mimpi.mp3 | 2022-08-09 19:43 | 2.6M | |
![[SND]](/icons/sound2.gif) | lagimuah.mp3 | 2022-08-09 19:42 | 0 | |
![[SND]](/icons/sound2.gif) | Чистое Небо - Гитара 16 (1).mp3 | 2022-08-09 19:35 | 0 | |
![[SND]](/icons/sound2.gif) | Павел Пламенев - Эй мёртвый! Проснись! (акустика).mp3 | 2022-08-09 19:33 | 0 | |
![[SND]](/icons/sound2.gif) | Wonder.mp3 | 2022-08-09 19:29 | 0 | |
![[SND]](/icons/sound2.gif) | Miracle.mp3 | 2022-08-09 19:25 | 0 | |
![[SND]](/icons/sound2.gif) | Crazier.mp3 | 2022-08-09 19:20 | 284K | |
![[SND]](/icons/sound2.gif) | Cutie.mp3 | 2022-08-09 19:15 | 2.6M | |
![[SND]](/icons/sound2.gif) | Ako.mp3 | 2022-08-09 19:13 | 0 | |
![[SND]](/icons/sound2.gif) | sforek.mp3 | 2022-08-09 19:11 | 0 | |
![[SND]](/icons/sound2.gif) | sax.mp3 | 2022-08-09 19:08 | 0 | |
![[SND]](/icons/sound2.gif) | tulok.mp3 | 2022-08-09 19:08 | 0 | |
![[SND]](/icons/sound2.gif) | Might.mp3 | 2022-08-09 19:07 | 0 | |
![[SND]](/icons/sound2.gif) | CHABAH2 (درجة الصوت -0.05 - سرعة إيقاع 103).mp3 | 2022-08-09 19:06 | 0 | |
![[SND]](/icons/sound2.gif) | mrv01.mp3 | 2022-08-09 19:05 | 0 | |
![[SND]](/icons/sound2.gif) | gimn-sssr-rossii-instrumentalnaya-zapis.mp3 | 2022-08-09 19:04 | 4.7M | |
![[SND]](/icons/sound2.gif) | CHABAH2.mp3 | 2022-08-09 19:03 | 0 | |
![[SND]](/icons/sound2.gif) | mrv.mp3 | 2022-08-09 19:00 | 0 | |
![[SND]](/icons/sound2.gif) | TIOO.mp3 | 2022-08-09 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | Tioosj.mp3 | 2022-08-09 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | ning1.mp3 | 2022-08-09 18:52 | 0 | |
![[SND]](/icons/sound2.gif) | ning2.mp3 | 2022-08-09 18:52 | 0 | |
![[SND]](/icons/sound2.gif) | ning3.mp3 | 2022-08-09 18:52 | 0 | |
![[SND]](/icons/sound2.gif) | ning5.mp3 | 2022-08-09 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | ning4.mp3 | 2022-08-09 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1657432160661.mp3 | 2022-08-09 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | Dj Bbhc Pyramid.mp3 | 2022-08-09 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | rz1.mp3 | 2022-08-09 18:50 | 0 | |
![[SND]](/icons/sound2.gif) | SaveTube.App - Eiyuu (Ultraman Nexus Operning) Lyrics (128 kbps) (1).mp3 | 2022-08-09 18:50 | 0 | |
![[SND]](/icons/sound2.gif) | SaveTube.App - Eiyuu (Ultraman Nexus Operning) Lyrics (128 kbps).mp3 | 2022-08-09 18:49 | 0 | |
![[SND]](/icons/sound2.gif) | JElektroforez_-_505_Legko_sojjti_s_uma_72662961.mp3 | 2022-08-09 18:48 | 0 | |
![[SND]](/icons/sound2.gif) | fenicks.mp3 | 2022-08-09 18:47 | 0 | |
![[SND]](/icons/sound2.gif) | Bones - Timberlake (ft. Juicy J).mp3 | 2022-08-09 18:47 | 0 | |
![[SND]](/icons/sound2.gif) | FelixVander.mp3 | 2022-08-09 18:44 | 5.9M | |
![[SND]](/icons/sound2.gif) | grave!.mp3 | 2022-08-09 18:39 | 3.3M | |
![[SND]](/icons/sound2.gif) | Koy.mp3 | 2022-08-09 18:37 | 8.9M | |
![[SND]](/icons/sound2.gif) | N4.mp3 | 2022-08-09 18:33 | 0 | |
![[SND]](/icons/sound2.gif) | Record (online-voice-recorder.com).mp3 | 2022-08-09 18:30 | 0 | |
![[SND]](/icons/sound2.gif) | Not Around - Nova.mp3 | 2022-08-09 18:30 | 0 | |
![[SND]](/icons/sound2.gif) | touch.mp3 | 2022-08-09 18:28 | 3.5M | |
![[SND]](/icons/sound2.gif) | 1515401487_gazirovka-black-www_muzonov_net.mp3 | 2022-08-09 18:28 | 0 | |
![[SND]](/icons/sound2.gif) | hamd.mp3 | 2022-08-09 18:27 | 0 | |
![[SND]](/icons/sound2.gif) | dqsng.mp3 | 2022-08-09 18:27 | 0 | |
![[SND]](/icons/sound2.gif) | hehe.mp3 | 2022-08-09 18:27 | 0 | |
![[SND]](/icons/sound2.gif) | 1096.mp3 | 2022-08-09 18:25 | 0 | |
![[SND]](/icons/sound2.gif) | ᴘᴏ_ᴋᴀɪꜰᴜ_🍷_кайфуша'_🤤✌🏿_Мастер_И_Маргарита(1).mp3 | 2022-08-09 18:24 | 0 | |
![[SND]](/icons/sound2.gif) | walwal.mp3 | 2022-08-09 18:24 | 6.3M | |
![[SND]](/icons/sound2.gif) | Sohigh.mp3 | 2022-08-09 18:24 | 0 | |
![[SND]](/icons/sound2.gif) | KRK FtNA Official MV Prod By Sakarin.mp3 | 2022-08-09 18:20 | 0 | |
![[SND]](/icons/sound2.gif) | So High.mp3 | 2022-08-09 18:17 | 0 | |
![[SND]](/icons/sound2.gif) | Bruno Mars, Anderson .Paak, Silk Sonic - Smokin Out The Window.mp3 | 2022-08-09 18:17 | 0 | |
![[SND]](/icons/sound2.gif) | zhalan-dunie-zhalan-eken.mp3 | 2022-08-09 18:15 | 0 | |
![[SND]](/icons/sound2.gif) | Suzume.mp3 | 2022-08-09 18:15 | 0 | |
![[SND]](/icons/sound2.gif) | Сектор Газа - ЛИРИКА PHONK EDITION PROD NERONUS (mp3-2020.com).mp3 | 2022-08-09 18:14 | 0 | |
![[SND]](/icons/sound2.gif) | jackmafia100.mp3 | 2022-08-09 18:13 | 0 | |
![[SND]](/icons/sound2.gif) | Press2pNick - John Muir.mp3 | 2022-08-09 18:13 | 0 | |
![[SND]](/icons/sound2.gif) | djhie1.mp3 | 2022-08-09 18:12 | 0 | |
![[SND]](/icons/sound2.gif) | Tulus - Monokrom - sped up.mp3 | 2022-08-09 18:12 | 0 | |
![[SND]](/icons/sound2.gif) | zhalan-dunie-zhalan-eken_(muzzona.kz).mp3 | 2022-08-09 18:11 | 0 | |
![[SND]](/icons/sound2.gif) | Malaak_Op.mp3 | 2022-08-09 18:11 | 0 | |
![[SND]](/icons/sound2.gif) | Mlk_1.mp3 | 2022-08-09 18:10 | 448K | |
![[SND]](/icons/sound2.gif) | DJ CLOSE YOUR EYES X GAM GAM TEKI TEKI VIRAL TIKTOK‼️DJ TIKTOK REMIX VIRAL 2022‼️.mp3 | 2022-08-09 18:05 | 4.0M | |
![[SND]](/icons/sound2.gif) | Тима Белорусских - Знаток.mp3 | 2022-08-09 18:05 | 7.1M | |
![[SND]](/icons/sound2.gif) | FelixGans.mp3 | 2022-08-09 18:04 | 31M | |
![[SND]](/icons/sound2.gif) | Sc2.mp3 | 2022-08-09 18:04 | 3.6M | |
![[SND]](/icons/sound2.gif) | Sc1.mp3 | 2022-08-09 18:04 | 3.2M | |
![[SND]](/icons/sound2.gif) | Hujan.mp3 | 2022-08-09 18:04 | 1.7M | |
![[SND]](/icons/sound2.gif) | dora-doradura-mp3 (1).mp3 | 2022-08-09 17:57 | 0 | |
![[SND]](/icons/sound2.gif) | MAHIKA.mp3 | 2022-08-09 17:55 | 3.1M | |
![[SND]](/icons/sound2.gif) | modern-talking-cheri-cheri-lady.mp3 | 2022-08-09 17:54 | 0 | |
![[SND]](/icons/sound2.gif) | helmandj7.mp3 | 2022-08-09 17:53 | 3.3M | |
![[SND]](/icons/sound2.gif) | ЧЁРНЫЕ ГЛАЗА - (phonk edition) (mp3day.net).mp3 | 2022-08-09 17:51 | 0 | |
![[SND]](/icons/sound2.gif) | helmandj8.mp3 | 2022-08-09 17:51 | 0 | |
![[SND]](/icons/sound2.gif) | Seinsong.mp3 | 2022-08-09 17:49 | 0 | |
![[SND]](/icons/sound2.gif) | 10467-irina-kairatovna-shiza-kok-tu.mp3 | 2022-08-09 17:48 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.app - PtrpStudio - ชอบเธออะ (Prod by. Sakarin) (128 kbps).mp3 | 2022-08-09 17:46 | 0 | |
![[SND]](/icons/sound2.gif) | Sein1.mp3 | 2022-08-09 17:44 | 556K | |
![[SND]](/icons/sound2.gif) | sad45.mp3 | 2022-08-09 17:44 | 0 | |
![[SND]](/icons/sound2.gif) | zawsze.mp3 | 2022-08-09 17:43 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.com - UN Owen Was Her - Nico Nico Douga ~ Ronald McDonald (128 kbps).mp3 | 2022-08-09 17:42 | 0 | |
![[SND]](/icons/sound2.gif) | fabdoua.mp3 | 2022-08-09 17:40 | 0 | |
![[SND]](/icons/sound2.gif) | alltype.mp3 | 2022-08-09 17:37 | 0 | |
![[SND]](/icons/sound2.gif) | St1.mp3 | 2022-08-09 17:35 | 3.4M | |
![[SND]](/icons/sound2.gif) | SnapTik_7124337818679201050.mp3 | 2022-08-09 17:35 | 0 | |
![[SND]](/icons/sound2.gif) | savannah.mp3 | 2022-08-09 17:35 | 0 | |
![[SND]](/icons/sound2.gif) | Tulusinteraksi3.mp3 | 2022-08-09 17:34 | 0 | |
![[SND]](/icons/sound2.gif) | Tulusjuni2.mp3 | 2022-08-09 17:33 | 0 | |
![[SND]](/icons/sound2.gif) | icalsad.mp3 | 2022-08-09 17:33 | 0 | |
![[SND]](/icons/sound2.gif) | Pesanterakhir1.mp3 | 2022-08-09 17:33 | 0 | |
![[VID]](/icons/movie.gif) | SnapTik_7126513311683743003.mp4 | 2022-08-09 17:30 | 0 | |
![[SND]](/icons/sound2.gif) | Until I Found You 💛Newest Arthur Miguel Non Stop Playlist 2022💛Bagong OPM Ibig Kanta 2022.mp3 | 2022-08-09 17:30 | 0 | |
![[SND]](/icons/sound2.gif) | TINDER ROLEPLAY - PROD BY MANGBORIS (Official Audio).mp3 | 2022-08-09 17:29 | 0 | |
![[SND]](/icons/sound2.gif) | #AJIMAT⚡ - MY GANG! (Official Music Video).mp3 | 2022-08-09 17:27 | 0 | |
![[SND]](/icons/sound2.gif) | sein.mp3 | 2022-08-09 17:26 | 0 | |
![[SND]](/icons/sound2.gif) | strumble.mp3 | 2022-08-09 17:25 | 0 | |
![[SND]](/icons/sound2.gif) | Dito.mp3 | 2022-08-09 17:25 | 3.5M | |
![[SND]](/icons/sound2.gif) | sikok bagi duo.mp3 | 2022-08-09 17:21 | 0 | |
![[SND]](/icons/sound2.gif) | Vendetta - Этот Дым - Miro Pircxalava.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | Скриптонит - Пацан [Chill Vibe Version by ERWI] - Constant Music.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | Иду Как И Шел - INFINITY MUSIC.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | Веселей - Скриптонит.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | ендшпиль-гости уйдут - legenda_13.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | Train Wreck - kizaru.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | Metro Pro - Valiko - Nextgen.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | 50 сеnt & Каспийский груз disco inferno - ☠️𝕯𝖊𝖆𝖉𝖑𝛄 𝖒𝖚𝖘𝖎𝖈☠️.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | H8.HOOD - PHANTOM (official music) - 1agares1.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | 01. Делюгу - Макухин.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | First Day Out - kizaru.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | DAIS - Glock - DAIS.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | 03. Его Крышуют Мусара - Макухин.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | •Как мне жаль ваши души• - Mara$ladkiy.mp3 | 2022-08-09 17:19 | 0 | |
![[SND]](/icons/sound2.gif) | TRT.mp3 | 2022-08-09 17:19 | 0 | |
![[SND]](/icons/sound2.gif) | 2008.mp3 | 2022-08-09 17:18 | 2.1M | |
![[SND]](/icons/sound2.gif) | tom1.mp3 | 2022-08-09 17:17 | 0 | |
![[SND]](/icons/sound2.gif) | HUM.mp3 | 2022-08-09 17:17 | 0 | |
![[SND]](/icons/sound2.gif) | chien.mp3 | 2022-08-09 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | odel.mp3 | 2022-08-09 17:14 | 0 | |
![[SND]](/icons/sound2.gif) | yeu.mp3 | 2022-08-09 17:14 | 0 | |
![[SND]](/icons/sound2.gif) | TST.mp3 | 2022-08-09 17:13 | 0 | |
![[SND]](/icons/sound2.gif) | showw.mp3 | 2022-08-09 17:13 | 0 | |
![[SND]](/icons/sound2.gif) | We asked Richard how he integrates rhetoric and phonetic delivery in his training and what is the unique methodology behind it (1).mp3 | 2022-08-09 17:12 | 0 | |
![[SND]](/icons/sound2.gif) | FIRST CONTACT STORIES OF THE CALL CENTER NOBELBIZ PODCAST. One of Richard Blank’s (CEO of Costa Rica's Call Center) strong suits is gamification company culture (3).mp3 | 2022-08-09 17:12 | 0 | |
![[SND]](/icons/sound2.gif) | FIRST CONTACT STORIES OF THE CALL CENTER NOBELBIZ PODCAST. One of Richard Blank’s (CEO of Costa Rica's Call Center) strong suits is balancing his time as a leader (2).mp3 | 2022-08-09 17:12 | 0 | |
![[SND]](/icons/sound2.gif) | despacito.mp3 | 2022-08-09 17:12 | 4.3M | |
![[SND]](/icons/sound2.gif) | During COVID-19, Costa Rica's Call Center's CEO, Richard Blank managed to keep having successful interactions, happy customers and engaged employees (1).mp3 | 2022-08-09 17:12 | 0 | |
![[SND]](/icons/sound2.gif) | The Art and Science of Call Center Success, with Richard Blank from Costa Rica's Call Center - Cutter Consulting Group.mp3 | 2022-08-09 17:11 | 0 | |
![[SND]](/icons/sound2.gif) | aboba.mp3 | 2022-08-09 17:10 | 0 | |
![[SND]](/icons/sound2.gif) | DJ Chechen - Чеченская лезгинка.mp3 | 2022-08-09 17:08 | 772K | |
![[SND]](/icons/sound2.gif) | alo.mp3 | 2022-08-09 17:08 | 4.3M | |
![[SND]](/icons/sound2.gif) | arcannistrp.mp3 | 2022-08-09 17:06 | 0 | |
![[SND]](/icons/sound2.gif) | arc.mp3 | 2022-08-09 17:06 | 0 | |
![[SND]](/icons/sound2.gif) | saep1.mp3 | 2022-08-09 17:03 | 0 | |
![[SND]](/icons/sound2.gif) | Dan.mp3 | 2022-08-09 17:02 | 2.4M | |
![[SND]](/icons/sound2.gif) | ngoisao.mp3 | 2022-08-09 16:57 | 0 | |
![[SND]](/icons/sound2.gif) | vf.mp3 | 2022-08-09 16:56 | 0 | |
![[SND]](/icons/sound2.gif) | sando.mp3 | 2022-08-09 16:53 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com_-_GTARPNETWORK_Heading.mp3 | 2022-08-09 16:52 | 0 | |
![[SND]](/icons/sound2.gif) | itsyouu.mp3 | 2022-08-09 16:48 | 0 | |
![[SND]](/icons/sound2.gif) | Diz3.mp3 | 2022-08-09 16:47 | 0 | |
![[SND]](/icons/sound2.gif) | wannamarry.mp3 | 2022-08-09 16:46 | 0 | |
![[SND]](/icons/sound2.gif) | Defamilita.mp3 | 2022-08-09 16:41 | 0 | |
![[SND]](/icons/sound2.gif) | Tadhana.mp3 | 2022-08-09 16:37 | 1.0M | |
![[SND]](/icons/sound2.gif) | ligaya.mp3 | 2022-08-09 16:34 | 444K | |
![[SND]](/icons/sound2.gif) | Katha.mp3 | 2022-08-09 16:33 | 0 | |
![[SND]](/icons/sound2.gif) | Ito.mp3 | 2022-08-09 16:33 | 0 | |
![[SND]](/icons/sound2.gif) | mhine.mp3 | 2022-08-09 16:33 | 0 | |
![[SND]](/icons/sound2.gif) | Ligaya.mp3 | 2022-08-09 16:32 | 0 | |
![[SND]](/icons/sound2.gif) | behh.mp3 | 2022-08-09 16:32 | 0 | |
![[SND]](/icons/sound2.gif) | Tokyo Ghoul - Opening (original).mp3 | 2022-08-09 16:32 | 0 | |
![[SND]](/icons/sound2.gif) | 6IX9INE - POLICE ft. 50 Cent (RapKing Music Video)(MP3_320K).mp3 | 2022-08-09 16:31 | 0 | |
![[SND]](/icons/sound2.gif) | [YT2mp3.info] - Mehro - perfume (Lyrics) (320kbps).mp3 | 2022-08-09 16:31 | 0 | |
![[SND]](/icons/sound2.gif) | kane + ketceh 😎☝.mp3 | 2022-08-09 16:27 | 0 | |
![[SND]](/icons/sound2.gif) | m49.mp3 | 2022-08-09 16:26 | 0 | |
![[SND]](/icons/sound2.gif) | lot.mp3 | 2022-08-09 16:26 | 0 | |
![[SND]](/icons/sound2.gif) | kash.mp3.mp3 | 2022-08-09 16:25 | 0 | |
![[SND]](/icons/sound2.gif) | youu.mp3 | 2022-08-09 16:25 | 0 | |
![[SND]](/icons/sound2.gif) | FiiyOzawa.mp3 | 2022-08-09 16:22 | 0 | |
![[SND]](/icons/sound2.gif) | DanMachi Season 4 Opening FullTentouby Sajou no Hana.mp3 | 2022-08-09 16:21 | 0 | |
![[SND]](/icons/sound2.gif) | Liga.mp3 | 2022-08-09 16:21 | 0 | |
![[SND]](/icons/sound2.gif) | Mine.mp3 | 2022-08-09 16:20 | 0 | |
![[SND]](/icons/sound2.gif) | BASS.mp3 | 2022-08-09 16:20 | 0 | |
![[SND]](/icons/sound2.gif) | inbound6601697356567906970.mp3 | 2022-08-09 16:16 | 0 | |
![[SND]](/icons/sound2.gif) | Metan_-_SHnurki_73239954.mp3 | 2022-08-09 16:16 | 0 | |
![[SND]](/icons/sound2.gif) | BASS1.mp3 | 2022-08-09 16:15 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ JEDAG JEDUG FULL BASS Lagu tik tok viral 2021 WilfexBor Terbaru (1).mp3 | 2022-08-09 16:15 | 0 | |
![[SND]](/icons/sound2.gif) | inbound7796932345223699318.mp3 | 2022-08-09 16:14 | 0 | |
![[SND]](/icons/sound2.gif) | ajh.mp3 | 2022-08-09 16:08 | 0 | |
![[SND]](/icons/sound2.gif) | musica-the-descent-kevin-macleod.mp3 | 2022-08-09 16:07 | 0 | |
![[SND]](/icons/sound2.gif) | wax1.mp3 | 2022-08-09 16:05 | 0 | |
![[SND]](/icons/sound2.gif) | trac.mp3 | 2022-08-09 16:05 | 0 | |
![[SND]](/icons/sound2.gif) | zlij_reper_zenik_-_gmo_(z2.fm).mp3 | 2022-08-09 15:58 | 0 | |
![[SND]](/icons/sound2.gif) | TP1.mp3 | 2022-08-09 15:48 | 0 | |
![[SND]](/icons/sound2.gif) | Sound1.mp3 | 2022-08-09 15:48 | 0 | |
![[SND]](/icons/sound2.gif) | Zxa12.mp3 | 2022-08-09 15:48 | 0 | |
![[SND]](/icons/sound2.gif) | Zxa11.mp3 | 2022-08-09 15:47 | 0 | |
![[SND]](/icons/sound2.gif) | Zxa10.mp3 | 2022-08-09 15:47 | 0 | |
![[SND]](/icons/sound2.gif) | lil-tecca-ransom-directed-by-cole-bennett-ytmp3juice.mp3 | 2022-08-09 15:45 | 0 | |
![[SND]](/icons/sound2.gif) | tiktok-i-just-can-t‼️-kevin-rater-remix-2021-ytmp3juice.mp3 | 2022-08-09 15:45 | 0 | |
![[SND]](/icons/sound2.gif) | mzlff-Нерпы все в адидасах (Original Version) [Peanzo Remix].mp3 | 2022-08-09 15:43 | 0 | |
![[SND]](/icons/sound2.gif) | DJBLDABTCH.mp3 | 2022-08-09 15:43 | 0 | |
![[SND]](/icons/sound2.gif) | LZ1.mp3 | 2022-08-09 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | LZ3.mp3 | 2022-08-09 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | LZ2.mp3 | 2022-08-09 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | LZ5.mp3 | 2022-08-09 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | LZ7.mp3 | 2022-08-09 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | LZ6.mp3 | 2022-08-09 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | Skofka_Nu_a_poki_budem_bit_vas_za_azov_i_Buchu.mp3 | 2022-08-09 15:41 | 0 | |
![[SND]](/icons/sound2.gif) | Eorp.mp3 | 2022-08-09 15:39 | 0 | |
![[SND]](/icons/sound2.gif) | high.mp3 | 2022-08-09 15:38 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Rizky Febian Seperti Kisah Official Lyric Video.mp3 | 2022-08-09 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | LZ.mp3 | 2022-08-09 15:36 | 2.4M | |
![[SND]](/icons/sound2.gif) | DJ BUILD A BITCH.mp3 | 2022-08-09 15:35 | 0 | |
![[SND]](/icons/sound2.gif) | ตบไมเคิ้ลเนเวอร์เฟียร์ By ทุเรียนซิ่ง.mp3 | 2022-08-09 15:35 | 0 | |
![[SND]](/icons/sound2.gif) | ตบไมเคิ้ลเนเวอร์เฟียร์ By ทุเรียนซิ่ง (online-audio-converter.com).mp3 | 2022-08-09 15:34 | 0 | |
![[SND]](/icons/sound2.gif) | nai.mp3 | 2022-08-09 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | vadcb.mp3 | 2022-08-09 15:29 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - iPhone New phone ringtone 2020 Best iPhone ringtone 2020 Apple ringtone 2020 download.mp3 | 2022-08-09 15:27 | 0 | |
![[SND]](/icons/sound2.gif) | Song10.mp3 | 2022-08-09 15:26 | 0 | |
![[SND]](/icons/sound2.gif) | HEE.mp3 | 2022-08-09 15:20 | 2.8M | |
![[SND]](/icons/sound2.gif) | y2mate.com - I Like You So Much Youll Know It Ysabelle Cuevas Lyrics .mp3 | 2022-08-09 15:15 | 1.0M | |
![[SND]](/icons/sound2.gif) | jackking.mp3 | 2022-08-09 15:14 | 0 | |
![[SND]](/icons/sound2.gif) | megalovania.mp3 | 2022-08-09 15:13 | 0 | |
![[SND]](/icons/sound2.gif) | mp3-2217615439921085-160687952498285.mp3 | 2022-08-09 15:13 | 0 | |
![[SND]](/icons/sound2.gif) | bls9.mp3 | 2022-08-09 15:12 | 0 | |
![[SND]](/icons/sound2.gif) | zaxn1.mp3 | 2022-08-09 15:10 | 0 | |
![[SND]](/icons/sound2.gif) | life.mp3 | 2022-08-09 15:10 | 0 | |
![[SND]](/icons/sound2.gif) | joby102.mp3 | 2022-08-09 15:06 | 0 | |
![[SND]](/icons/sound2.gif) | ransom.mp3 | 2022-08-09 15:04 | 0 | |
![[SND]](/icons/sound2.gif) | incalabas3.mp3 | 2022-08-09 15:03 | 0 | |
![[SND]](/icons/sound2.gif) | U-Rays (Tutorial) - F-Zero GX [OST].mp3 | 2022-08-09 15:03 | 232K | |
![[SND]](/icons/sound2.gif) | oopkmmmm.mp3 | 2022-08-09 15:03 | 0 | |
![[SND]](/icons/sound2.gif) | 9amincalabasas.mp3 | 2022-08-09 15:02 | 0 | |
![[SND]](/icons/sound2.gif) | ll1.mp3 | 2022-08-09 15:02 | 0 | |
![[SND]](/icons/sound2.gif) | FFMAX.mp3 | 2022-08-09 15:00 | 0 | |
![[SND]](/icons/sound2.gif) | kkkkkkkho.mp3 | 2022-08-09 14:59 | 3.1M | |
![[SND]](/icons/sound2.gif) | walk.mp3 | 2022-08-09 14:59 | 4.2M | |
![[SND]](/icons/sound2.gif) | chuta5.mp3 | 2022-08-09 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | chuta4.mp3 | 2022-08-09 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | chuta3.mp3 | 2022-08-09 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | chuta2.mp3 | 2022-08-09 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | chuta.mp3 | 2022-08-09 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | chuta1.mp3 | 2022-08-09 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | Travis Scott - Antidote (Lyrics On Screen).mp3 | 2022-08-09 14:56 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Arctic Monkeys I Wanna Be Yours Lyrics.mp3 | 2022-08-09 14:56 | 0 | |
![[SND]](/icons/sound2.gif) | CallGirl-TrungTu-7344918.mp3 | 2022-08-09 14:53 | 0 | |
![[SND]](/icons/sound2.gif) | Redoxy Был друг стал враг_9zbk.mp3 | 2022-08-09 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | vacation.mp3 | 2022-08-09 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | uuwian.mp3 | 2022-08-09 14:49 | 0 | |
![[SND]](/icons/sound2.gif) | paypal-hold-song.mp3 | 2022-08-09 14:49 | 0 | |
![[SND]](/icons/sound2.gif) | savage.mp3 | 2022-08-09 14:49 | 0 | |
![[SND]](/icons/sound2.gif) | options.mp3 | 2022-08-09 14:48 | 0 | |
![[SND]](/icons/sound2.gif) | lintik.mp3 | 2022-08-09 14:48 | 0 | |
![[SND]](/icons/sound2.gif) | lifegoeson.mp3 | 2022-08-09 14:48 | 3.2M | |
![[SND]](/icons/sound2.gif) | kungikay.mp3 | 2022-08-09 14:47 | 1.5M | |
![[SND]](/icons/sound2.gif) | itsyou.mp3 | 2022-08-09 14:47 | 1.5M | |
![[SND]](/icons/sound2.gif) | ispy.mp3 | 2022-08-09 14:47 | 0 | |
![[SND]](/icons/sound2.gif) | heatwaves.mp3 | 2022-08-09 14:47 | 3.2M | |
![[SND]](/icons/sound2.gif) | habangbuhay.mp3 | 2022-08-09 14:46 | 3.8M | |
![[SND]](/icons/sound2.gif) | deathbed.mp3 | 2022-08-09 14:46 | 1.1M | |
![[SND]](/icons/sound2.gif) | comethru.mp3 | 2022-08-09 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | chilllang.mp3 | 2022-08-09 14:46 | 4.5M | |
![[SND]](/icons/sound2.gif) | buwan.mp3 | 2022-08-09 14:45 | 7.8M | |
![[SND]](/icons/sound2.gif) | bilog.mp3 | 2022-08-09 14:45 | 1.5M | |
![[SND]](/icons/sound2.gif) | beautiful.mp3 | 2022-08-09 14:45 | 4.5M | |
![[SND]](/icons/sound2.gif) | io1.mp3 | 2022-08-09 14:41 | 0 | |
![[SND]](/icons/sound2.gif) | Pa.mp3 | 2022-08-09 14:39 | 0 | |
![[SND]](/icons/sound2.gif) | Pala1.mp3 | 2022-08-09 14:38 | 0 | |
![[SND]](/icons/sound2.gif) | Tiara01.mp3 | 2022-08-09 14:37 | 0 | |
![[SND]](/icons/sound2.gif) | snowfall.mp3 | 2022-08-09 14:37 | 0 | |
![[SND]](/icons/sound2.gif) | wells-hold-song.mp3 | 2022-08-09 14:37 | 1.3M | |
![[SND]](/icons/sound2.gif) | prokol.mp3.mp3 | 2022-08-09 14:36 | 0 | |
![[SND]](/icons/sound2.gif) | Glen1.mp3 | 2022-08-09 14:34 | 0 | |
![[SND]](/icons/sound2.gif) | Pala.mp3 | 2022-08-09 14:33 | 1.5M | |
![[SND]](/icons/sound2.gif) | Newsong70.mp3 | 2022-08-09 14:31 | 0 | |
![[SND]](/icons/sound2.gif) | Glen17.mp3 | 2022-08-09 14:31 | 1.1M | |
![[SND]](/icons/sound2.gif) | music.mp3 | 2022-08-09 14:31 | 764K | |
![[SND]](/icons/sound2.gif) | topromanticsong.mp3 | 2022-08-09 14:31 | 0 | |
![[SND]](/icons/sound2.gif) | PALEDES.mp3 | 2022-08-09 14:28 | 0 | |
![[SND]](/icons/sound2.gif) | bass.mp3 | 2022-08-09 14:28 | 4.9M | |
![[SND]](/icons/sound2.gif) | djcuky2.mp3 | 2022-08-09 14:26 | 1.1M | |
![[SND]](/icons/sound2.gif) | Wells Fargo Hold Music (2021).mp3 | 2022-08-09 14:21 | 1.3M | |
![[SND]](/icons/sound2.gif) | Theo1.mp3 | 2022-08-09 14:21 | 135K | |
![[SND]](/icons/sound2.gif) | Sukzessive Approximation (DJ Cannabis Coffeeshops Deutschland).mp3 | 2022-08-09 14:20 | 0 | |
![[SND]](/icons/sound2.gif) | 2019-03-17_-_Too_Crazy_-_David_Fesliyan.mp3 | 2022-08-09 14:19 | 0 | |
![[SND]](/icons/sound2.gif) | Lucky1.mp3 | 2022-08-09 14:14 | 0 | |
![[SND]](/icons/sound2.gif) | Sad3.mp3 | 2022-08-09 14:13 | 840K | |
![[SND]](/icons/sound2.gif) | [YT2mp3.info] - Joji - Glimpse of Us (320kbps).mp3 | 2022-08-09 14:10 | 8.9M | |
![[SND]](/icons/sound2.gif) | VaGanza.mp3 | 2022-08-09 14:10 | 0 | |
![[SND]](/icons/sound2.gif) | [YT2mp3.info] - Beach Bunny - Cloud 9 (Official Music Video) (320kbps).mp3 | 2022-08-09 14:09 | 0 | |
![[SND]](/icons/sound2.gif) | rascal.mp3 | 2022-08-09 14:05 | 0 | |
![[SND]](/icons/sound2.gif) | Highway.mp3 | 2022-08-09 14:03 | 0 | |
![[SND]](/icons/sound2.gif) | FullSenyum.mp3 | 2022-08-09 13:59 | 4.2M | |
![[SND]](/icons/sound2.gif) | LOVE.mp3 | 2022-08-09 13:59 | 0 | |
![[SND]](/icons/sound2.gif) | panda.mp3 | 2022-08-09 13:56 | 4.8M | |
![[SND]](/icons/sound2.gif) | PecahSeribu.mp3 | 2022-08-09 13:56 | 0 | |
![[SND]](/icons/sound2.gif) | test1.mp3 | 2022-08-09 13:54 | 4.2M | |
![[SND]](/icons/sound2.gif) | life3.mp3 | 2022-08-09 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | cars1.mp3 | 2022-08-09 13:52 | 0 | |
![[SND]](/icons/sound2.gif) | Djfede1.mp3 | 2022-08-09 13:48 | 0 | |
![[SND]](/icons/sound2.gif) | kolor.mp3 | 2022-08-09 13:46 | 0 | |
![[SND]](/icons/sound2.gif) | SAMSONS.mp3 | 2022-08-09 13:44 | 0 | |
![[SND]](/icons/sound2.gif) | ganda.mp3 | 2022-08-09 13:40 | 0 | |
![[SND]](/icons/sound2.gif) | Hills.mp3 | 2022-08-09 13:39 | 0 | |
![[SND]](/icons/sound2.gif) | PARALUMAN.mp3 | 2022-08-09 13:39 | 0 | |
![[SND]](/icons/sound2.gif) | RagnBone Man - Human.mp3 | 2022-08-09 13:35 | 0 | |
![[SND]](/icons/sound2.gif) | prombl_-_myulee_(musmore.com).mp3 | 2022-08-09 13:30 | 0 | |
![[SND]](/icons/sound2.gif) | Sweet.mp3 | 2022-08-09 13:28 | 3.4M | |
![[SND]](/icons/sound2.gif) | Mehabooba.mp3 | 2022-08-09 13:27 | 1.2M | |
![[SND]](/icons/sound2.gif) | Chill.mp3 | 2022-08-09 13:25 | 72K | |
![[SND]](/icons/sound2.gif) | Bmw.mp3 | 2022-08-09 13:24 | 2.5M | |
![[SND]](/icons/sound2.gif) | abtag5.mp3 | 2022-08-09 13:22 | 0 | |
![[SND]](/icons/sound2.gif) | moonnik.mp3 | 2022-08-09 13:19 | 0 | |
![[SND]](/icons/sound2.gif) | MOON.mp3 | 2022-08-09 13:17 | 0 | |
![[SND]](/icons/sound2.gif) | THUONGQUAXA.mp3 | 2022-08-09 13:17 | 0 | |
![[SND]](/icons/sound2.gif) | united in flames cut.mp3 | 2022-08-09 13:16 | 0 | |
![[SND]](/icons/sound2.gif) | KaiZ2.mp3 | 2022-08-09 13:13 | 0 | |
![[SND]](/icons/sound2.gif) | EroplanongPapel.mp3 | 2022-08-09 13:12 | 0 | |
![[SND]](/icons/sound2.gif) | Until5.mp3 | 2022-08-09 13:12 | 0 | |
![[SND]](/icons/sound2.gif) | Idealessappealing.mp3 | 2022-08-09 13:09 | 0 | |
![[SND]](/icons/sound2.gif) | AMALEDI (1).mp3 | 2022-08-09 13:09 | 0 | |
![[SND]](/icons/sound2.gif) | PTT-20220809-WA0025.mp3 | 2022-08-09 13:08 | 0 | |
![[SND]](/icons/sound2.gif) | box.mp3 | 2022-08-09 13:08 | 1.8M | |
![[SND]](/icons/sound2.gif) | Fai Rumore (ESC 2022 SF1 Live).mp3 | 2022-08-09 13:07 | 0 | |
![[SND]](/icons/sound2.gif) | Asmodeus - AI.mp3 | 2022-08-09 13:07 | 0 | |
![[SND]](/icons/sound2.gif) | y2meta.com - Last Child - DUKA (Official Lyric Video) (128 kbps).mp3 | 2022-08-09 13:05 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1659706519639.mp3 | 2022-08-09 13:05 | 0 | |
![[SND]](/icons/sound2.gif) | Beruntung.mp3 | 2022-08-09 13:04 | 0 | |
![[SND]](/icons/sound2.gif) | Asmodeus - AI.m4a | 2022-08-09 13:04 | 0 | |
![[SND]](/icons/sound2.gif) | parti2.mp3 | 2022-08-09 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | playlist-sad-2hour.mp3 | 2022-08-09 13:00 | 0 | |
![[SND]](/icons/sound2.gif) | haroun.mp3 | 2022-08-09 12:58 | 0 | |
![[SND]](/icons/sound2.gif) | Rain World THS - Garbage City Shuffle.mp3 | 2022-08-09 12:55 | 0 | |
![[SND]](/icons/sound2.gif) | dangdutslebew1.mp3 | 2022-08-09 12:55 | 0 | |
![[SND]](/icons/sound2.gif) | inbound4252352553164717993.mp3 | 2022-08-09 12:55 | 0 | |
![[SND]](/icons/sound2.gif) | snap1.mp3 | 2022-08-09 12:54 | 0 | |
![[SND]](/icons/sound2.gif) | tegar.mp3 | 2022-08-09 12:52 | 3.6M | |
![[SND]](/icons/sound2.gif) | Darci2.mp3 | 2022-08-09 12:51 | 0 | |
![[SND]](/icons/sound2.gif) | Big_Baby_Tape_kizaru_-_99_Problems_73212020.mp3 | 2022-08-09 12:51 | 6.2M | |
![[SND]](/icons/sound2.gif) | better.mp3 | 2022-08-09 12:50 | 3.2M | |
![[SND]](/icons/sound2.gif) | y2mate.com - Eyes blue or brown cant remember terpikat senyummu Heather X Eyes Blue Lirik Dan Terjemahan.mp3 | 2022-08-09 12:50 | 0 | |
![[SND]](/icons/sound2.gif) | Luha.mp3 | 2022-08-09 12:50 | 0 | |
![[SND]](/icons/sound2.gif) | y5.mp3 | 2022-08-09 12:50 | 0 | |
![[SND]](/icons/sound2.gif) | y4.mp3 | 2022-08-09 12:50 | 0 | |
![[SND]](/icons/sound2.gif) | y2.mp3 | 2022-08-09 12:49 | 0 | |
![[SND]](/icons/sound2.gif) | y3.mp3 | 2022-08-09 12:49 | 0 | |
![[SND]](/icons/sound2.gif) | y1.mp3 | 2022-08-09 12:49 | 0 | |
![[SND]](/icons/sound2.gif) | Ballin Down.mp3 | 2022-08-09 12:47 | 0 | |
![[SND]](/icons/sound2.gif) | Porque.mp3 | 2022-08-09 12:45 | 0 | |
![[SND]](/icons/sound2.gif) | mp1.mp3 | 2022-08-09 12:41 | 1.7M | |
![[SND]](/icons/sound2.gif) | Darci.mp3 | 2022-08-09 12:39 | 0 | |
![[SND]](/icons/sound2.gif) | Kambulat — Но ты кидаешь в игнор (Muzqa.net) (www.lightaudio.ru).mp3 | 2022-08-09 12:38 | 0 | |
![[SND]](/icons/sound2.gif) | Empilight.mp3 | 2022-08-09 12:36 | 0 | |
![[SND]](/icons/sound2.gif) | Oliver.mp3 | 2022-08-09 12:36 | 0 | |
![[SND]](/icons/sound2.gif) | ЛИТВИНЕНКО - Исправим.mp3 | 2022-08-09 12:36 | 2.4M | |
![[SND]](/icons/sound2.gif) | y2mate.com - DARCION MY OWN LYRICS.mp3 | 2022-08-09 12:35 | 0 | |
![[SND]](/icons/sound2.gif) | JIKA.mp3 | 2022-08-09 12:32 | 0 | |
![[SND]](/icons/sound2.gif) | Har20.mp3 | 2022-08-09 12:31 | 3.6M | |
![[SND]](/icons/sound2.gif) | tiengxehoi.mp3 | 2022-08-09 12:21 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - New GM ChevyGMCCadillac Door Chime Sound Effect HQ.mp3 | 2022-08-09 12:20 | 0 | |
![[SND]](/icons/sound2.gif) | adsasdasd.mp3 | 2022-08-09 12:12 | 0 | |
![[SND]](/icons/sound2.gif) | vjudjhfgkvgz.mp3 | 2022-08-09 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | bollywoodFM - Детство.mp3 | 2022-08-09 12:11 | 3.0M | |
![[SND]](/icons/sound2.gif) | 1650353842_2xrkrnskpsn2022rk8fbcq0k128kbs.mp3 | 2022-08-09 12:08 | 8.8M | |
![[SND]](/icons/sound2.gif) | washing.mp3 | 2022-08-09 12:05 | 1.8M | |
![[SND]](/icons/sound2.gif) | mscrumby.mp3 | 2022-08-09 12:04 | 2.1M | |
![[SND]](/icons/sound2.gif) | nokomens.mp3 | 2022-08-09 11:54 | 5.9M | |
![[SND]](/icons/sound2.gif) | rfquake.mp3 | 2022-08-09 11:52 | 4.2M | |
![[SND]](/icons/sound2.gif) | lmanana.mp3 | 2022-08-09 11:51 | 8.8M | |
![[SND]](/icons/sound2.gif) | crmby.mp3 | 2022-08-09 11:51 | 2.1M | |
![[SND]](/icons/sound2.gif) | campuran.mp3 | 2022-08-09 11:48 | 53M | |
![[SND]](/icons/sound2.gif) | Crazy - Patrick Patrikios.mp3 | 2022-08-09 11:44 | 5.1M | |
![[SND]](/icons/sound2.gif) | Макс Корж - 2 типа людей.mp3 | 2022-08-09 11:43 | 9.8M | |
![[SND]](/icons/sound2.gif) | s2.mp3 | 2022-08-09 11:38 | 4.3M | |
![[SND]](/icons/sound2.gif) | 10.mp3 | 2022-08-09 11:35 | 172K | |
![[SND]](/icons/sound2.gif) | Iskorpio - MABAGHICH (Official Music Audio).[Mpgun.com].mp3 | 2022-08-09 11:32 | 0 | |
![[SND]](/icons/sound2.gif) | naruto.mp3 | 2022-08-09 11:32 | 0 | |
![[SND]](/icons/sound2.gif) | rege2.mp3 | 2022-08-09 11:31 | 0 | |
![[SND]](/icons/sound2.gif) | XD.mp3 | 2022-08-09 11:31 | 0 | |
![[SND]](/icons/sound2.gif) | KarnaMereka - Cerita Malam (Lirik).mp3 | 2022-08-09 11:30 | 0 | |
![[SND]](/icons/sound2.gif) | Randa1.mp3 | 2022-08-09 11:29 | 1.5M | |
![[SND]](/icons/sound2.gif) | Akin.mp3 | 2022-08-09 11:28 | 0 | |
![[SND]](/icons/sound2.gif) | dopan.mp3 | 2022-08-09 11:27 | 0 | |
![[SND]](/icons/sound2.gif) | KLIA.mp3 | 2022-08-09 11:27 | 0 | |
![[SND]](/icons/sound2.gif) | vtornik_-_Dzhoni_Vonker_73215538.mp3 | 2022-08-09 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | mp5.mp3 | 2022-08-09 11:25 | 4.9M | |
![[SND]](/icons/sound2.gif) | listrap1.mp3 | 2022-08-09 11:24 | 22M | |
![[SND]](/icons/sound2.gif) | listrap.mp3 | 2022-08-09 11:24 | 19M | |
![[SND]](/icons/sound2.gif) | KVA1.mp3 | 2022-08-09 11:21 | 128K | |
![[SND]](/icons/sound2.gif) | mp4.mp3 | 2022-08-09 11:17 | 3.2M | |
![[SND]](/icons/sound2.gif) | kelaz.mp3 | 2022-08-09 11:16 | 0 | |
![[SND]](/icons/sound2.gif) | ha1.mp3 | 2022-08-09 11:16 | 1.8M | |
![[SND]](/icons/sound2.gif) | mp3.mp3 | 2022-08-09 11:15 | 1.1M | |
![[SND]](/icons/sound2.gif) | AUD-20220124-WA0172.mp3 | 2022-08-09 11:13 | 0 | |
![[SND]](/icons/sound2.gif) | SNA.mp3 | 2022-08-09 11:13 | 0 | |
![[SND]](/icons/sound2.gif) | Кино - Закрой за мной дверь, я ухожу.mp3 | 2022-08-09 11:12 | 0 | |
![[SND]](/icons/sound2.gif) | no3.mp3 | 2022-08-09 11:12 | 0 | |
![[SND]](/icons/sound2.gif) | SHINE7.mp3 | 2022-08-09 11:12 | 0 | |
![[SND]](/icons/sound2.gif) | Beethoven Violin concerto 3rd movement, Toshiya Eto soloist.mp3 | 2022-08-09 11:11 | 0 | |
![[SND]](/icons/sound2.gif) | xxxmanera-never-broke-again-mp3.mp3 | 2022-08-09 11:09 | 0 | |
![[SND]](/icons/sound2.gif) | no1.mp3 | 2022-08-09 11:09 | 0 | |
![[VID]](/icons/movie.gif) | WhatsApp Audio 2022-08-08 at 11.06.32 AM.mp4 | 2022-08-09 11:09 | 0 | |
![[SND]](/icons/sound2.gif) | no2.mp3 | 2022-08-09 11:08 | 0 | |
![[SND]](/icons/sound2.gif) | Jakomo, A.V.G, MACAN - Самый молодой.mp3 | 2022-08-09 11:08 | 0 | |
![[SND]](/icons/sound2.gif) | 🔊💣😈Iliusha🔊💣😈-🖤 Пару водников 🖤-kissvk.com.mp3 | 2022-08-09 11:07 | 0 | |
![[SND]](/icons/sound2.gif) | ТГК - Там таз стелит.mp3 | 2022-08-09 11:07 | 1.0M | |
![[SND]](/icons/sound2.gif) | ha.mp3 | 2022-08-09 11:06 | 2.0M | |
![[SND]](/icons/sound2.gif) | ilja_toka__tutbass_-_ilja_toka__tam__gde_nam_ksenon_osveshchaet_tuman_(z2.fm).mp3 | 2022-08-09 11:03 | 6.6M | |
![[VID]](/icons/movie.gif) | DJ1.mp4 | 2022-08-09 11:02 | 0 | |
![[SND]](/icons/sound2.gif) | PD.mp3 | 2022-08-09 10:59 | 2.3M | |
![[SND]](/icons/sound2.gif) | Диман Брюханов - Давай вкатаемся братан_(muzfan.net).mp3 | 2022-08-09 10:59 | 7.1M | |
![[SND]](/icons/sound2.gif) | sed1.mp3 | 2022-08-09 10:58 | 0 | |
![[SND]](/icons/sound2.gif) | Liam1.mp3 | 2022-08-09 10:57 | 7.5M | |
![[SND]](/icons/sound2.gif) | Mr. Credo - Медляк (CXNVTVS flip) (www.hotplayer.ru).mp3 | 2022-08-09 10:56 | 0 | |
![[SND]](/icons/sound2.gif) | ask.mp3 | 2022-08-09 10:56 | 0 | |
![[SND]](/icons/sound2.gif) | Randa3.mp3 | 2022-08-09 10:55 | 0 | |
![[SND]](/icons/sound2.gif) | SM.mp3 | 2022-08-09 10:55 | 3.0M | |
![[SND]](/icons/sound2.gif) | Randa.mp3 | 2022-08-09 10:54 | 3.4M | |
![[SND]](/icons/sound2.gif) | Chin-Giz - Ствол.mp3 | 2022-08-09 10:53 | 5.5M | |
![[SND]](/icons/sound2.gif) | Need You Lyrics Ex Battalion ft Jroa.mp3 | 2022-08-09 10:50 | 0 | |
![[SND]](/icons/sound2.gif) | PLVTINUM Tarro Champagne Sunshine Lyrics British men do it best TikTok Song.mp3 | 2022-08-09 10:50 | 0 | |
![[SND]](/icons/sound2.gif) | mahika.mp3 | 2022-08-09 10:50 | 0 | |
![[SND]](/icons/sound2.gif) | tite.mp3 | 2022-08-09 10:49 | 0 | |
![[SND]](/icons/sound2.gif) | gamitin nang babae.mp3 | 2022-08-09 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | The Walters I Love You So.mp3 | 2022-08-09 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | Like A Virgin Lyrics Video Madonna.mp3 | 2022-08-09 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | Aqua Barbie Girl.mp3 | 2022-08-09 10:47 | 0 | |
![[SND]](/icons/sound2.gif) | Lo Ki Manifest Official Music Video.mp3 | 2022-08-09 10:47 | 1.4M | |
![[SND]](/icons/sound2.gif) | David3.mp3 | 2022-08-09 10:47 | 2.3M | |
![[SND]](/icons/sound2.gif) | Philippine National Anthem Lupang Hinirang TLEN.mp3 | 2022-08-09 10:47 | 0 | |
![[SND]](/icons/sound2.gif) | PH.mp3 | 2022-08-09 10:44 | 0 | |
![[SND]](/icons/sound2.gif) | SPEEDY SOUNDS & ENTERTAINMENT PIANO MIX #003.mp3 | 2022-08-09 10:42 | 0 | |
![[SND]](/icons/sound2.gif) | Who's Lovin You.mp3 | 2022-08-09 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | Tickle me pink.mp3 | 2022-08-09 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Lintik.mp3 | 2022-08-09 10:37 | 0 | |
![[SND]](/icons/sound2.gif) | sbw1.mp3 | 2022-08-09 10:36 | 0 | |
![[SND]](/icons/sound2.gif) | dgn1.mp3 | 2022-08-09 10:33 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Juice WRLD The Weeknd Smile Official Video.mp3 | 2022-08-09 10:29 | 0 | |
![[SND]](/icons/sound2.gif) | joji_glimpse_of_us_1062941230036325777.mp3 | 2022-08-09 10:28 | 0 | |
![[SND]](/icons/sound2.gif) | djsalira.mp3 | 2022-08-09 10:28 | 0 | |
![[SND]](/icons/sound2.gif) | Joji-SLOW-DANCING-IN-THE-DARK_K3Qzzggn--s.mp3 | 2022-08-09 10:28 | 0 | |
![[SND]](/icons/sound2.gif) | before-I-close-my-eyes_2EpBqtqf8Go.mp3 | 2022-08-09 10:27 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Juice WRLD Empty Official Audio.mp3 | 2022-08-09 10:27 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Rich Brian Yellow ft Bekon Official Video.mp3 | 2022-08-09 10:27 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Rich Brian Drive Safe Lyric Video.mp3 | 2022-08-09 10:26 | 0 | |
![[SND]](/icons/sound2.gif) | 想見你.mp3 | 2022-08-09 10:22 | 1.8M | |
![[SND]](/icons/sound2.gif) | atlanta.mp3 | 2022-08-09 10:19 | 4.4M | |
![[SND]](/icons/sound2.gif) | beatgat1.mp3 | 2022-08-09 10:19 | 220K | |
![[SND]](/icons/sound2.gif) | beatgat.mp3 | 2022-08-09 10:19 | 2.5M | |
![[SND]](/icons/sound2.gif) | beat1.mp3 | 2022-08-09 10:19 | 2.3M | |
![[SND]](/icons/sound2.gif) | morgenshtern-timati-el-problema-mp3.mp3 | 2022-08-09 10:16 | 5.3M | |
![[SND]](/icons/sound2.gif) | trekkkk.mp3 | 2022-08-09 10:13 | 0 | |
![[SND]](/icons/sound2.gif) | alt-J - Breezeblocks (Lyrics).mp3 | 2022-08-09 10:11 | 0 | |
![[SND]](/icons/sound2.gif) | -_Pro_samp_rp_(Gybka.com).mp3 | 2022-08-09 10:09 | 0 | |
![[SND]](/icons/sound2.gif) | morgenshtern-eldzhej-cadillac-club-remix-by-skazka-music-mp3.mp3 | 2022-08-09 10:09 | 0 | |
![[SND]](/icons/sound2.gif) | lexzy3.mp3 | 2022-08-09 10:06 | 0 | |
![[SND]](/icons/sound2.gif) | sasageo.mp3 | 2022-08-09 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_1.mp3 | 2022-08-09 10:02 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_11.mp3 | 2022-08-09 10:01 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_12.mp3 | 2022-08-09 10:01 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_2.mp3 | 2022-08-09 10:01 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_7.mp3 | 2022-08-09 09:59 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_13.mp3 | 2022-08-09 09:59 | 0 | |
![[SND]](/icons/sound2.gif) | Miyagi, Andy Panda - Utopia (mp3day.net).mp3 | 2022-08-09 09:58 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_6.mp3 | 2022-08-09 09:58 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_9.mp3 | 2022-08-09 09:58 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_4.mp3 | 2022-08-09 09:58 | 0 | |
![[SND]](/icons/sound2.gif) | FAJRIA.mp3 | 2022-08-09 09:57 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_10.mp3 | 2022-08-09 09:57 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_3.mp3 | 2022-08-09 09:56 | 0 | |
![[SND]](/icons/sound2.gif) | ganvest-durnaya-mp3.mp3 | 2022-08-09 09:56 | 0 | |
![[SND]](/icons/sound2.gif) | для мта 8 — военкомат (www.lightaudio.ru).mp3 | 2022-08-09 09:53 | 0 | |
![[SND]](/icons/sound2.gif) | Happy Asmara - Tatu [OFFICIAL].mp3 | 2022-08-09 09:53 | 0 | |
![[SND]](/icons/sound2.gif) | WOW.mp3 | 2022-08-09 09:51 | 0 | |
![[SND]](/icons/sound2.gif) | lexzy1.mp3 | 2022-08-09 09:49 | 0 | |
![[SND]](/icons/sound2.gif) | love3.mp3 | 2022-08-09 09:48 | 0 | |
![[SND]](/icons/sound2.gif) | hcdbf.mp3 | 2022-08-09 09:47 | 0 | |
![[SND]](/icons/sound2.gif) | Djpk1.mp3 | 2022-08-09 09:46 | 0 | |
![[SND]](/icons/sound2.gif) | Ебанько - Я ебу собак.mp3 | 2022-08-09 09:46 | 2.2M | |
![[SND]](/icons/sound2.gif) | AUD-20220809-WA0308.mp3 | 2022-08-09 09:46 | 0 | |
![[SND]](/icons/sound2.gif) | efekgedhangkluthuk.mp3 | 2022-08-09 09:35 | 0 | |
![[SND]](/icons/sound2.gif) | qwe.mp3 | 2022-08-09 09:31 | 2.6M | |
![[SND]](/icons/sound2.gif) | ⛱ Travel Vlog No Copyright Chill Summer Background Music for Video _ Anywhere by shandr & Nick Perry (2).mp3 | 2022-08-09 09:31 | 0 | |
![[SND]](/icons/sound2.gif) | Ебанько - Еби меня.mp3 | 2022-08-09 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_5.mp3 | 2022-08-09 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | atme.mp3 | 2022-08-09 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | phulu.mp3 | 2022-08-09 09:27 | 0 | |
![[SND]](/icons/sound2.gif) | AUD-20220809-WA0314.m4a | 2022-08-09 09:27 | 0 | |
![[SND]](/icons/sound2.gif) | remixx.mp3 | 2022-08-09 09:25 | 0 | |
![[SND]](/icons/sound2.gif) | duka.mp3 | 2022-08-09 09:23 | 5.1M | |
![[VID]](/icons/movie.gif) | sms.mp4 | 2022-08-09 09:19 | 78K | |
![[VID]](/icons/movie.gif) | GABUT2.mp4 | 2022-08-09 09:17 | 0 | |
![[VID]](/icons/movie.gif) | GABUT1.mp4 | 2022-08-09 09:17 | 0 | |
![[SND]](/icons/sound2.gif) | india.mp3 | 2022-08-09 09:17 | 0 | |
![[SND]](/icons/sound2.gif) | dangdut3.mp3 | 2022-08-09 09:16 | 0 | |
![[SND]](/icons/sound2.gif) | dangdut2.mp3 | 2022-08-09 09:16 | 1.4M | |
![[SND]](/icons/sound2.gif) | Baby.mp3 | 2022-08-09 09:15 | 2.0M | |
![[SND]](/icons/sound2.gif) | gamora_-_bazaru_net_(z2.fm).mp3 | 2022-08-09 09:08 | 0 | |
![[VID]](/icons/movie.gif) | VID-20220731-WA0012.mp4 | 2022-08-09 09:08 | 3.1M | |
![[SND]](/icons/sound2.gif) | Dije2.mp3 | 2022-08-09 09:07 | 2.7M | |
![[VID]](/icons/movie.gif) | VID-20220724-WA0006.mp4 | 2022-08-09 09:07 | 0 | |
![[SND]](/icons/sound2.gif) | Joko tingkirr.mp3 | 2022-08-09 09:06 | 5.3M | |
![[SND]](/icons/sound2.gif) | Awd1.mp3 | 2022-08-09 09:03 | 148K | |
![[SND]](/icons/sound2.gif) | Asb1.mp3 | 2022-08-09 08:59 | 0 | |
![[SND]](/icons/sound2.gif) | CN - Atomwaffen Division.mp3 | 2022-08-09 08:56 | 0 | |
![[SND]](/icons/sound2.gif) | Brk1.mp3 | 2022-08-09 08:50 | 0 | |
![[SND]](/icons/sound2.gif) | bro2.mp3 | 2022-08-09 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | Dd1.mp3 | 2022-08-09 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | Gg33.mp3 | 2022-08-09 08:47 | 400K | |
![[SND]](/icons/sound2.gif) | PANICX, SH3TLVIZ - Give Em Hell.mp3 | 2022-08-09 08:45 | 0 | |
![[SND]](/icons/sound2.gif) | Strom1.mp3 | 2022-08-09 08:44 | 0 | |
![[SND]](/icons/sound2.gif) | Music Cover l 66,We are Badguy,JAK Founder (RB Version).mp3 | 2022-08-09 08:42 | 0 | |
![[SND]](/icons/sound2.gif) | TBA.mp3 | 2022-08-09 08:38 | 0 | |
![[SND]](/icons/sound2.gif) | tose1.mp3 | 2022-08-09 08:36 | 0 | |
![[SND]](/icons/sound2.gif) | seto5.mp3 | 2022-08-09 08:31 | 0 | |
![[SND]](/icons/sound2.gif) | AZBest5.mp3 | 2022-08-09 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | renz1.mp3 | 2022-08-09 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | AZBest2.mp3 | 2022-08-09 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | AZBest3.mp3 | 2022-08-09 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | AZBest1.mp3 | 2022-08-09 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | Debt Collection - Outbound - Follow-up call.mp3 | 2022-08-09 08:20 | 0 | |
![[SND]](/icons/sound2.gif) | AsiaZoneRPBest4.mp3 | 2022-08-09 08:19 | 0 | |
![[SND]](/icons/sound2.gif) | AsiaZoneRPBest2.mp3 | 2022-08-09 08:19 | 0 | |
![[SND]](/icons/sound2.gif) | AsiaZoneRPBest1.mp3 | 2022-08-09 08:19 | 0 | |
![[SND]](/icons/sound2.gif) | AsiaZoneRPBest5.mp3 | 2022-08-09 08:19 | 0 | |
![[SND]](/icons/sound2.gif) | AsiaZoneRPBest3.mp3 | 2022-08-09 08:18 | 0 | |
![[SND]](/icons/sound2.gif) | genggeng.mp3 | 2022-08-09 08:17 | 300K | |
![[SND]](/icons/sound2.gif) | 01 DJ CONRAY - HELLO SUMMER AMAPIANO MIX (1).mp3 | 2022-08-09 08:16 | 0 | |
![[SND]](/icons/sound2.gif) | gang.mp3 | 2022-08-09 08:12 | 0 | |
![[SND]](/icons/sound2.gif) | D42_3.mp3 | 2022-08-09 08:10 | 0 | |
![[SND]](/icons/sound2.gif) | vip3.mp3 | 2022-08-09 08:06 | 0 | |
![[SND]](/icons/sound2.gif) | D42_2.mp3 | 2022-08-09 08:05 | 0 | |
![[SND]](/icons/sound2.gif) | D42_1.mp3 | 2022-08-09 08:05 | 0 | |
![[SND]](/icons/sound2.gif) | laskarpelangi.mp3 | 2022-08-09 08:04 | 3.1M | |
![[SND]](/icons/sound2.gif) | sabilulung.mp3 | 2022-08-09 08:03 | 2.6M | |
![[SND]](/icons/sound2.gif) | yt1s.com - Breaking Bad Main Title Theme Extended.mp3 | 2022-08-09 08:03 | 0 | |
![[SND]](/icons/sound2.gif) | partyfavor.mp3 | 2022-08-09 08:01 | 3.7M | |
![[SND]](/icons/sound2.gif) | vserana.mp3 | 2022-08-09 07:59 | 0 | |
![[SND]](/icons/sound2.gif) | DJ AINT MY FAULT SLOWED VIRAL TIK TOK TERBARU 2022 YANG KALIAN CARI .mp3 | 2022-08-09 07:58 | 2.3M | |
![[SND]](/icons/sound2.gif) | D44.mp3 | 2022-08-09 07:57 | 232K | |
![[SND]](/icons/sound2.gif) | DJ+TELOLET+BY+DJ+SOPAN.mp3 | 2022-08-09 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | D42.mp3 | 2022-08-09 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | bibo.mp3 | 2022-08-09 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | lc.mp3 | 2022-08-09 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | asede.mp3 | 2022-08-09 07:54 | 0 | |
![[SND]](/icons/sound2.gif) | serana.mp3 | 2022-08-09 07:53 | 0 | |
![[SND]](/icons/sound2.gif) | cium.mp3 | 2022-08-09 07:52 | 0 | |
![[SND]](/icons/sound2.gif) | sempurna.mp3 | 2022-08-09 07:50 | 4.0M | |
![[SND]](/icons/sound2.gif) | love.mp3 | 2022-08-09 07:47 | 1.2M | |
![[SND]](/icons/sound2.gif) | bentrentanglau.mp3 | 2022-08-09 07:46 | 0 | |
![[SND]](/icons/sound2.gif) | beauty.mp3 | 2022-08-09 07:44 | 0 | |
![[SND]](/icons/sound2.gif) | december.mp3 | 2022-08-09 07:42 | 3.3M | |
![[SND]](/icons/sound2.gif) | kaso.mp3 | 2022-08-09 07:38 | 0 | |
![[SND]](/icons/sound2.gif) | loguo1.mp3 | 2022-08-09 07:37 | 2.4M | |
![[SND]](/icons/sound2.gif) | MAXMENGKEREN.mp3 | 2022-08-09 07:37 | 451K | |
![[SND]](/icons/sound2.gif) | xdhii1.mp3 | 2022-08-09 07:36 | 0 | |
![[SND]](/icons/sound2.gif) | 7125391394302429978.mp3 | 2022-08-09 07:35 | 0 | |
![[SND]](/icons/sound2.gif) | MuthukaleIkkaethittund.mp3 | 2022-08-09 07:33 | 0 | |
![[SND]](/icons/sound2.gif) | xz.mp3 | 2022-08-09 07:31 | 3.2M | |
![[SND]](/icons/sound2.gif) | co.mp3 | 2022-08-09 07:30 | 2.9M | |
![[SND]](/icons/sound2.gif) | hmaz1.mp3 | 2022-08-09 07:29 | 3.8M | |
![[SND]](/icons/sound2.gif) | AUD-20220729-WA0004.mp3 | 2022-08-09 07:28 | 209K | |
![[SND]](/icons/sound2.gif) | flyme.mp3 | 2022-08-09 07:27 | 2.9M | |
![[VID]](/icons/movie.gif) | 100.000.k_1659661158_musicaldown.com.mp4 | 2022-08-09 07:27 | 1.8M | |
![[SND]](/icons/sound2.gif) | secretlove.mp3 | 2022-08-09 07:26 | 3.8M | |
![[SND]](/icons/sound2.gif) | beachbunny1.mp3 | 2022-08-09 07:22 | 2.3M | |
![[SND]](/icons/sound2.gif) | acabo.mp3 | 2022-08-09 07:19 | 8.1M | |
![[SND]](/icons/sound2.gif) | na.mp3 | 2022-08-09 07:19 | 2.3M | |
![[SND]](/icons/sound2.gif) | remix2.mp3 | 2022-08-09 07:18 | 4.5M | |
![[SND]](/icons/sound2.gif) | kutahan.mp3 | 2022-08-09 07:17 | 1.2M | |
![[SND]](/icons/sound2.gif) | Radita.mp3 | 2022-08-09 07:11 | 120K | |
![[SND]](/icons/sound2.gif) | wonder.mp3 | 2022-08-09 07:08 | 2.7M | |
![[SND]](/icons/sound2.gif) | slow.mp3 | 2022-08-09 07:08 | 1.2M | |
![[SND]](/icons/sound2.gif) | phonk-killer-green-orxnge-madness_104015874.mp3 | 2022-08-09 07:03 | 0 | |
![[SND]](/icons/sound2.gif) | theshade.mp3 | 2022-08-09 06:59 | 1.9M | |
![[SND]](/icons/sound2.gif) | Sidekick.mp3 | 2022-08-09 06:55 | 0 | |
![[SND]](/icons/sound2.gif) | tam2000.mp3 | 2022-08-09 06:54 | 0 | |
![[SND]](/icons/sound2.gif) | yss.mp3 | 2022-08-09 06:51 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ SIKOK BAGI DUO REMIX PALEMBANG JEDAG JEDUG MENGKANE VIRAL TIKTOK (2).mp3 | 2022-08-09 06:43 | 0 | |
![[SND]](/icons/sound2.gif) | لحن حزين بدون كلمات 2021 - موسيقى حزينة تخليك تراجع أفعالك 💔.mp3 | 2022-08-09 06:42 | 0 | |
![[SND]](/icons/sound2.gif) | undertel.mp3 | 2022-08-09 06:39 | 0 | |
![[SND]](/icons/sound2.gif) | mxnarchNightwing.mp3 | 2022-08-09 06:38 | 0 | |
![[SND]](/icons/sound2.gif) | 1630639076_fogel-bogatymi-2.mp3 | 2022-08-09 06:38 | 0 | |
![[SND]](/icons/sound2.gif) | bones-hdmi-chopped-and-screwed-by-hardhammi.mp3 | 2022-08-09 06:34 | 0 | |
![[SND]](/icons/sound2.gif) | Rock.mp3 | 2022-08-09 06:33 | 5.1M | |
![[SND]](/icons/sound2.gif) | 120080oon-120071eity-go_456240723.mp3 | 2022-08-09 06:32 | 0 | |
![[SND]](/icons/sound2.gif) | FindMyName - Show me your back.mp3 | 2022-08-09 06:31 | 0 | |
![[SND]](/icons/sound2.gif) | M.mp3 | 2022-08-09 06:31 | 2.4M | |
![[SND]](/icons/sound2.gif) | xxxmanera-NeverBrokeAgain(musmore.com).mp3 | 2022-08-09 06:30 | 0 | |
![[SND]](/icons/sound2.gif) | Canon.mp3 | 2022-08-09 06:29 | 0 | |
![[SND]](/icons/sound2.gif) | taktau.mp3 | 2022-08-09 06:26 | 1.2M | |
![[SND]](/icons/sound2.gif) | broker.mp3 | 2022-08-09 06:25 | 2.8M | |
![[SND]](/icons/sound2.gif) | Lugowo.mp3 | 2022-08-09 06:22 | 8.4M | |
![[SND]](/icons/sound2.gif) | y2mate.m4a | 2022-08-09 06:21 | 958K | |
![[SND]](/icons/sound2.gif) | geng02.mp3 | 2022-08-09 06:20 | 2.6M | |
![[SND]](/icons/sound2.gif) | geng01.mp3 | 2022-08-09 06:20 | 4.4M | |
![[SND]](/icons/sound2.gif) | mix.mp3 | 2022-08-09 06:20 | 11M | |
![[VID]](/icons/movie.gif) | httpswww.mp4 | 2022-08-09 06:19 | 3.3M | |
![[SND]](/icons/sound2.gif) | s8.mp3 | 2022-08-09 06:17 | 0 | |
![[SND]](/icons/sound2.gif) | Neo.mp3 | 2022-08-09 06:16 | 0 | |
![[SND]](/icons/sound2.gif) | DIL2.mp3 | 2022-08-09 06:14 | 0 | |
![[SND]](/icons/sound2.gif) | DIL1.mp3 | 2022-08-09 06:14 | 0 | |
![[SND]](/icons/sound2.gif) | DIL3.mp3 | 2022-08-09 06:14 | 0 | |
![[SND]](/icons/sound2.gif) | final_62f18d113ce3bf0066abf1b0_130277.mp3 | 2022-08-09 06:08 | 0 | |
![[SND]](/icons/sound2.gif) | prescriptionkid.mp3 | 2022-08-09 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | Ito Ang Liga PBA.mp3 | 2022-08-09 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | Djviraltt.mp3 | 2022-08-09 06:04 | 0 | |
![[SND]](/icons/sound2.gif) | dappam.mp3.mp3 | 2022-08-09 06:01 | 0 | |
![[SND]](/icons/sound2.gif) | die.mp3 | 2022-08-09 05:58 | 4.0M | |
![[SND]](/icons/sound2.gif) | One.mp3 | 2022-08-09 05:56 | 4.2M | |
![[SND]](/icons/sound2.gif) | [lagu1s.com]TRICKSTER ANTHEM.oE6DQp1BAP8.mp3 | 2022-08-09 05:54 | 0 | |
![[SND]](/icons/sound2.gif) | Czerny op.849 no.1.mp3 | 2022-08-09 05:52 | 0 | |
![[SND]](/icons/sound2.gif) | teriak.mp3 | 2022-08-09 05:49 | 3.3M | |
![[SND]](/icons/sound2.gif) | tipex.mp3 | 2022-08-09 05:46 | 2.7M | |
![[SND]](/icons/sound2.gif) | ssstik_1652526939748.mp3 | 2022-08-09 05:46 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1653374373576.mp3 | 2022-08-09 05:44 | 0 | |
![[SND]](/icons/sound2.gif) | ZentaMusicyea.mp3 | 2022-08-09 05:44 | 0 | |
![[SND]](/icons/sound2.gif) | Opasnyjj_-_Opasnyjj_khud_71073513.mp3 | 2022-08-09 05:43 | 0 | |
![[SND]](/icons/sound2.gif) | JEldzhi_-_Mojj_Rajjon_69081944.mp3 | 2022-08-09 05:42 | 0 | |
![[SND]](/icons/sound2.gif) | Sektor_Gaza_-_CHastushki_55189352.mp3 | 2022-08-09 05:38 | 7.7M | |
![[SND]](/icons/sound2.gif) | s5.mp3 | 2022-08-09 05:33 | 3.8M | |
![[SND]](/icons/sound2.gif) | the-smiths-the-boy-with-the-thorn-in-his-side.mp3 | 2022-08-09 05:32 | 0 | |
![[SND]](/icons/sound2.gif) | eldzhey-rastvoritel.mp3 | 2022-08-09 05:30 | 1.7M | |
![[SND]](/icons/sound2.gif) | set12.mp3 | 2022-08-09 05:29 | 2.9M | |
![[SND]](/icons/sound2.gif) | dreamgirl.mp3 | 2022-08-09 05:24 | 0 | |
![[SND]](/icons/sound2.gif) | cuy.mp3 | 2022-08-09 05:19 | 0 | |
![[SND]](/icons/sound2.gif) | ReZox8.mp3 | 2022-08-09 05:18 | 0 | |
![[SND]](/icons/sound2.gif) | WhereIsTheLove.mp3 | 2022-08-09 05:16 | 0 | |
![[SND]](/icons/sound2.gif) | seto3.mp3 | 2022-08-09 05:16 | 0 | |
![[SND]](/icons/sound2.gif) | DaEK4.mp3 | 2022-08-09 05:16 | 0 | |
![[SND]](/icons/sound2.gif) | seto2.mp3 | 2022-08-09 05:16 | 0 | |
![[SND]](/icons/sound2.gif) | Ton3.mp3 | 2022-08-09 05:15 | 0 | |
![[SND]](/icons/sound2.gif) | YraF5.mp3 | 2022-08-09 05:12 | 0 | |
![[SND]](/icons/sound2.gif) | Avtosh_-_Huligan_(iPleer.com).mp3 | 2022-08-09 05:11 | 0 | |
![[SND]](/icons/sound2.gif) | BRDYVV_-_Avtosh_Xuligan_66898732.mp3 | 2022-08-09 05:11 | 0 | |
![[SND]](/icons/sound2.gif) | Fw5X.mp3 | 2022-08-09 05:09 | 0 | |
![[SND]](/icons/sound2.gif) | SrAf5.m4a | 2022-08-09 05:05 | 0 | |
![[SND]](/icons/sound2.gif) | GARa4s.mp3 | 2022-08-09 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | CYSec.mp3 | 2022-08-09 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | ZhR24.mp3 | 2022-08-09 04:58 | 0 | |
![[SND]](/icons/sound2.gif) | dingincuy.mp3 | 2022-08-09 04:58 | 0 | |
![[SND]](/icons/sound2.gif) | SkrA5.mp3 | 2022-08-09 04:56 | 0 | |
![[SND]](/icons/sound2.gif) | LeeGa5.mp3 | 2022-08-09 04:53 | 0 | |
![[SND]](/icons/sound2.gif) | GaSt1.mp3 | 2022-08-09 04:51 | 0 | |
![[SND]](/icons/sound2.gif) | GaSt4.mp3 | 2022-08-09 04:49 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Lofi_HanyalahMimpi.mp3 | 2022-08-09 04:48 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Lofi_YangKuInginkan.mp3 | 2022-08-09 04:48 | 0 | |
![[SND]](/icons/sound2.gif) | Google.mp3 | 2022-08-09 04:48 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Yasobi_Daijobu.mp3 | 2022-08-09 04:48 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Gustixa_Kobbo.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_7_Orange.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_JKT48_FortuneCookie.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_JKT48_SemutMerah.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Lofi_Bersamamu.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Vierra_YangKuInginkan.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Vierra_Seandainya.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | CYS01Q.mp3 | 2022-08-09 04:45 | 0 | |
![[SND]](/icons/sound2.gif) | CloseYEyes.mp3 | 2022-08-09 04:43 | 0 | |
![[SND]](/icons/sound2.gif) | Dayang23.mp3 | 2022-08-09 04:37 | 7.5M | |
![[SND]](/icons/sound2.gif) | GaSt5.mp3 | 2022-08-09 04:36 | 5.9M | |
![[SND]](/icons/sound2.gif) | Nightcore - Demons.mp3 | 2022-08-09 04:35 | 5.1M | |
![[SND]](/icons/sound2.gif) | (Extended) Llusion X Banakula - Midnight Sun (Ramzoid Remix).mp3 | 2022-08-09 04:33 | 9.2M | |
![[SND]](/icons/sound2.gif) | Demi Lovato - Cool For The Summer [vzvuke.net].mp3 | 2022-08-09 04:33 | 0 | |
![[SND]](/icons/sound2.gif) | finikfinya__aleks_ataman_-_a_na_rukah_snezhinki_(z2.fm).mp3 | 2022-08-09 04:32 | 0 | |
![[SND]](/icons/sound2.gif) | fatbelly__abdr_-_bokal_(slowed_remix)_muzati.net.mp3 | 2022-08-09 04:28 | 0 | |
![[SND]](/icons/sound2.gif) | inbound2598099215265422569.mp3 | 2022-08-09 04:22 | 0 | |
![[SND]](/icons/sound2.gif) | BAGAIKAN LANGIT - POTRET Piano Cover (1).mp3 | 2022-08-09 04:21 | 0 | |
![[SND]](/icons/sound2.gif) | CYS.mp3 | 2022-08-09 04:17 | 0 | |
![[SND]](/icons/sound2.gif) | jdMga8.mp3 | 2022-08-09 04:15 | 0 | |
![[SND]](/icons/sound2.gif) | ftyuhbb.mp3 | 2022-08-09 04:14 | 0 | |
![[SND]](/icons/sound2.gif) | coli.mp3 | 2022-08-09 04:11 | 0 | |
![[SND]](/icons/sound2.gif) | Aga2Dj.mp3 | 2022-08-09 04:10 | 0 | |
![[SND]](/icons/sound2.gif) | gaR8f.mp3 | 2022-08-09 04:06 | 0 | |
![[SND]](/icons/sound2.gif) | united.mp3 | 2022-08-09 04:04 | 0 | |
![[SND]](/icons/sound2.gif) | Agazt2.mp3 | 2022-08-09 04:01 | 0 | |
![[SND]](/icons/sound2.gif) | XdaGa9.mp3 | 2022-08-09 03:58 | 0 | |
![[SND]](/icons/sound2.gif) | XdaGa1.mp3 | 2022-08-09 03:56 | 0 | |
![[SND]](/icons/sound2.gif) | GamonDek.mp3 | 2022-08-09 03:56 | 0 | |
![[SND]](/icons/sound2.gif) | pakwong.mp3 | 2022-08-09 03:51 | 4.3M | |
![[SND]](/icons/sound2.gif) | indah.mp3 | 2022-08-09 03:50 | 3.7M | |
![[SND]](/icons/sound2.gif) | secukupnya.mp3 | 2022-08-09 03:48 | 2.8M | |
![[SND]](/icons/sound2.gif) | derixs.mp3 | 2022-08-09 03:48 | 0 | |
![[SND]](/icons/sound2.gif) | AgaRa3.mp3 | 2022-08-09 03:46 | 1.7M | |
![[SND]](/icons/sound2.gif) | sai1.mp3 | 2022-08-09 03:45 | 0 | |
![[SND]](/icons/sound2.gif) | agS1r.mp3 | 2022-08-09 03:44 | 0 | |
![[SND]](/icons/sound2.gif) | KolxChill.mp3 | 2022-08-09 03:41 | 1.1M | |
![[SND]](/icons/sound2.gif) | drumsbums.mp3 | 2022-08-09 03:40 | 2.3M | |
![[SND]](/icons/sound2.gif) | elisha1.mp3 | 2022-08-09 03:39 | 404K | |
![[SND]](/icons/sound2.gif) | ABRAM.mp3 | 2022-08-09 03:39 | 391K | |
![[SND]](/icons/sound2.gif) | resah.mp3 | 2022-08-09 03:38 | 3.3M | |
![[SND]](/icons/sound2.gif) | AgRa4f.mp3 | 2022-08-09 03:38 | 352K | |
![[SND]](/icons/sound2.gif) | rumah.mp3 | 2022-08-09 03:35 | 2.2M | |
![[SND]](/icons/sound2.gif) | AgaTs3.mp3 | 2022-08-09 03:34 | 0 | |
![[SND]](/icons/sound2.gif) | BXBXK.mp3 | 2022-08-09 03:31 | 0 | |
![[SND]](/icons/sound2.gif) | rain.mp3 | 2022-08-09 03:30 | 1.7M | |
![[SND]](/icons/sound2.gif) | heaven.mp3 | 2022-08-09 03:29 | 5.4M | |
![[SND]](/icons/sound2.gif) | AgaT3.mp3 | 2022-08-09 03:28 | 0 | |
![[SND]](/icons/sound2.gif) | Ma.mp3 | 2022-08-09 03:26 | 1.1M | |
![[SND]](/icons/sound2.gif) | Mixx.mp3 | 2022-08-09 03:25 | 1.2M | |
![[SND]](/icons/sound2.gif) | Thin.mp3 | 2022-08-09 03:25 | 1.5M | |
![[SND]](/icons/sound2.gif) | KGF2.mp3 | 2022-08-09 03:24 | 0 | |
![[SND]](/icons/sound2.gif) | Ruth B. - Dandelions (Lyrics) slowed reverb (128 kbps) (YTmp3xd.com).mp3 | 2022-08-09 03:23 | 0 | |
![[SND]](/icons/sound2.gif) | ฉลามชอบงับคุณ - Bonnadol Feat IIVY B [ เนื้อเพลง ] (1).mp3 | 2022-08-09 03:23 | 2.9M | |
![[SND]](/icons/sound2.gif) | Rafae2.mp3 | 2022-08-09 03:21 | 0 | |
![[SND]](/icons/sound2.gif) | LOW.mp3 | 2022-08-09 03:17 | 0 | |
![[SND]](/icons/sound2.gif) | malingakala.mp3 | 2022-08-09 03:16 | 156K | |
![[SND]](/icons/sound2.gif) | Rafae1.mp3 | 2022-08-09 03:10 | 4.1M | |
![[SND]](/icons/sound2.gif) | Uyirini Uyire.mp3 | 2022-08-09 02:49 | 0 | |
![[SND]](/icons/sound2.gif) | CRUMBY.mp3 | 2022-08-09 02:44 | 0 | |
![[SND]](/icons/sound2.gif) | ELMANANA.mp3 | 2022-08-09 02:29 | 0 | |
![[SND]](/icons/sound2.gif) | EARFQUAKE.mp3 | 2022-08-09 02:23 | 0 | |
![[SND]](/icons/sound2.gif) | Rage Music.mp3 | 2022-08-09 02:19 | 0 | |
![[SND]](/icons/sound2.gif) | Track_002.mp3 | 2022-08-09 02:11 | 0 | |
![[SND]](/icons/sound2.gif) | Track_001.mp3 | 2022-08-09 02:09 | 0 | |
![[SND]](/icons/sound2.gif) | PaperAwaySound.mp3 | 2022-08-09 02:03 | 0 | |
![[SND]](/icons/sound2.gif) | 21.mp3 | 2022-08-09 01:57 | 88K | |
![[SND]](/icons/sound2.gif) | vcy.mp3 | 2022-08-09 01:57 | 1.0M | |
![[SND]](/icons/sound2.gif) | request14.mp3 | 2022-08-09 01:55 | 4.5M | |
![[SND]](/icons/sound2.gif) | request42.mp3 | 2022-08-09 01:54 | 3.1M | |
![[SND]](/icons/sound2.gif) | jackie.mp3 | 2022-08-09 01:49 | 1.5M | |
![[SND]](/icons/sound2.gif) | TP.mp3 | 2022-08-09 01:49 | 0 | |
![[SND]](/icons/sound2.gif) | UN.mp3 | 2022-08-09 01:49 | 0 | |
![[SND]](/icons/sound2.gif) | UY.mp3 | 2022-08-09 01:48 | 5.8M | |
![[SND]](/icons/sound2.gif) | charge it tho.mp3 | 2022-08-09 01:48 | 3.2M | |
![[SND]](/icons/sound2.gif) | KM.mp3 | 2022-08-09 01:47 | 8.3M | |
![[SND]](/icons/sound2.gif) | dandelions.mp3 | 2022-08-09 01:46 | 3.6M | |
![[SND]](/icons/sound2.gif) | lemontree.mp3 | 2022-08-09 01:45 | 1.9M | |
![[SND]](/icons/sound2.gif) | ET.mp3 | 2022-08-09 01:45 | 0 | |
![[SND]](/icons/sound2.gif) | EK.mp3 | 2022-08-09 01:45 | 0 | |
![[SND]](/icons/sound2.gif) | Paubaya.mp3 | 2022-08-09 01:38 | 0 | |
![[SND]](/icons/sound2.gif) | i.mp3 | 2022-08-09 01:29 | 2.8M | |
![[SND]](/icons/sound2.gif) | ejpogi.mp3 | 2022-08-09 01:17 | 0 | |
![[SND]](/icons/sound2.gif) | Yowis.mp3 | 2022-08-09 01:16 | 0 | |
![[SND]](/icons/sound2.gif) | malam1.mp3 | 2022-08-09 01:08 | 1.0M | |
![[SND]](/icons/sound2.gif) | keluh1.mp3 | 2022-08-09 01:04 | 0 | |
![[SND]](/icons/sound2.gif) | WizKid ft. Tems - Essence (Violin Cover) _ Tyler Butler-Figueroa.mp3 | 2022-08-09 01:00 | 0 | |
![[SND]](/icons/sound2.gif) | ajg.m4a | 2022-08-09 00:45 | 0 | |
![[SND]](/icons/sound2.gif) | Xe1.mp3 | 2022-08-09 00:34 | 0 | |
![[SND]](/icons/sound2.gif) | Caca.mp3 | 2022-08-09 00:30 | 4.3M | |
![[SND]](/icons/sound2.gif) | Cep1.mp3 | 2022-08-09 00:29 | 0 | |
![[SND]](/icons/sound2.gif) | tapydi.mp3 | 2022-08-09 00:29 | 0 | |
![[SND]](/icons/sound2.gif) | dos0.mp3 | 2022-08-09 00:28 | 0 | |
![[SND]](/icons/sound2.gif) | keluhmalam.mp3 | 2022-08-09 00:27 | 0 | |
![[SND]](/icons/sound2.gif) | Cep.mp3 | 2022-08-09 00:24 | 0 | |
![[SND]](/icons/sound2.gif) | 30.mp3 | 2022-08-09 00:22 | 88K | |
![[SND]](/icons/sound2.gif) | yt1s.com - Ngaca dulu Woy ANJAR OXS FEAT RYAN RAP.mp3 | 2022-08-09 00:14 | 0 | |
![[SND]](/icons/sound2.gif) | jandaai.mp3 | 2022-08-09 00:13 | 0 | |
![[SND]](/icons/sound2.gif) | Final_Composition_without_the_blank_space.mp3 | 2022-08-09 00:04 | 0 | |
![[SND]](/icons/sound2.gif) | lfreda.mp3 | 2022-08-09 00:01 | 0 | |
![[SND]](/icons/sound2.gif) | paramuda.mp3 | 2022-08-08 23:38 | 0 | |
![[SND]](/icons/sound2.gif) | sepanjang.mp3 | 2022-08-08 23:37 | 0 | |
![[SND]](/icons/sound2.gif) | Young Star - Trap Da School [Prod. Steid Onee].mp3 | 2022-08-08 23:37 | 0 | |
![[SND]](/icons/sound2.gif) | polisiiii.mp3 | 2022-08-08 23:33 | 0 | |
![[SND]](/icons/sound2.gif) | djlegowo2.mp3 | 2022-08-08 23:33 | 0 | |
![[SND]](/icons/sound2.gif) | free-cyberpunk-music-no-copyright-inception.mp3 | 2022-08-08 23:20 | 0 | |
![[SND]](/icons/sound2.gif) | merovingian-vivaldi-2.mp3 | 2022-08-08 23:19 | 0 | |
![[SND]](/icons/sound2.gif) | TIKUS.mp3 | 2022-08-08 23:12 | 0 | |
![[SND]](/icons/sound2.gif) | VITO1.mp3 | 2022-08-08 23:11 | 0 | |
![[SND]](/icons/sound2.gif) | polisiiiii.mp3 | 2022-08-08 23:06 | 2.7M | |
![[SND]](/icons/sound2.gif) | Bicycle.m4a | 2022-08-08 22:43 | 1.1M | |
![[SND]](/icons/sound2.gif) | START.mp3 | 2022-08-08 22:35 | 0 | |
![[SND]](/icons/sound2.gif) | AMIE's Voice Cover #956876.mp3 | 2022-08-08 22:33 | 0 | |
![[SND]](/icons/sound2.gif) | Warriyo - Mortals (feat. Laura Brehm) [NCS Release].mp3 | 2022-08-08 22:28 | 596K | |
![[SND]](/icons/sound2.gif) | C.mp3 | 2022-08-08 22:28 | 525K | |
![[SND]](/icons/sound2.gif) | Andy Panda feat. Miyagi - Endorphin.mp3 | 2022-08-08 22:24 | 0 | |
![[SND]](/icons/sound2.gif) | Zeann3.mp3 | 2022-08-08 22:06 | 0 | |
![[SND]](/icons/sound2.gif) | Zeann4.mp3 | 2022-08-08 22:05 | 0 | |
![[SND]](/icons/sound2.gif) | Zeann2.mp3 | 2022-08-08 22:04 | 0 | |
![[SND]](/icons/sound2.gif) | Zeann1.mp3 | 2022-08-08 22:04 | 0 | |
![[SND]](/icons/sound2.gif) | playamane-nateki-midnight-mp3.mp3 | 2022-08-08 22:02 | 0 | |
![[SND]](/icons/sound2.gif) | KSLV_Noh_-_Override_(musmore.com).mp3 | 2022-08-08 22:01 | 0 | |
![[SND]](/icons/sound2.gif) | E.mp3 | 2022-08-08 21:54 | 6.2M | |
![[SND]](/icons/sound2.gif) | D.mp3 | 2022-08-08 21:54 | 3.8M | |
![[SND]](/icons/sound2.gif) | yt1s.com - Chikh Mourad Alik Hna Ki Dayrin Remix.mp3 | 2022-08-08 21:39 | 0 | |
![[SND]](/icons/sound2.gif) | vitalyaigraetvbrawlstars.mp3 | 2022-08-08 21:36 | 3.1M | |
![[SND]](/icons/sound2.gif) | Arabic Remix - Ya Lili Samet Koban Remix.mp3 | 2022-08-08 21:33 | 0 | |
![[SND]](/icons/sound2.gif) | RS16.mp3 | 2022-08-08 21:31 | 0 | |
![[SND]](/icons/sound2.gif) | ralph01.mp3.mp3 | 2022-08-08 21:28 | 0 | |
![[SND]](/icons/sound2.gif) | 1605779284_lyube-davay-za.mp3 | 2022-08-08 21:22 | 0 | |
![[VID]](/icons/movie.gif) | Disem za tebe.mp4 | 2022-08-08 21:20 | 840K | |
![[SND]](/icons/sound2.gif) | Tat1.mp3 | 2022-08-08 21:16 | 0 | |
![[SND]](/icons/sound2.gif) | closee1.mp3 | 2022-08-08 21:15 | 0 | |
![[SND]](/icons/sound2.gif) | - — Атака титанов (opening 1) (www.lightaudio.ru).mp3 | 2022-08-08 21:13 | 0 | |
![[SND]](/icons/sound2.gif) | kevin.mp3 | 2022-08-08 21:10 | 0 | |
![[SND]](/icons/sound2.gif) | ralph01.mp3 | 2022-08-08 21:09 | 0 | |
![[SND]](/icons/sound2.gif) | 22 Track22.mp3 | 2022-08-08 21:09 | 0 | |
![[SND]](/icons/sound2.gif) | 21 Track21.mp3 | 2022-08-08 21:09 | 0 | |
![[SND]](/icons/sound2.gif) | 19 Track19.mp3 | 2022-08-08 21:08 | 0 | |
![[SND]](/icons/sound2.gif) | 17 Track17.mp3 | 2022-08-08 21:08 | 0 | |
![[SND]](/icons/sound2.gif) | 11 Track11.mp3 | 2022-08-08 21:07 | 0 | |
![[SND]](/icons/sound2.gif) | 18 Track18.mp3 | 2022-08-08 21:07 | 0 | |
![[SND]](/icons/sound2.gif) | MENGSADVIBES.mp3 | 2022-08-08 21:07 | 2.5M | |
![[SND]](/icons/sound2.gif) | 15 Track15.mp3 | 2022-08-08 21:06 | 0 | |
![[SND]](/icons/sound2.gif) | KANEGES.mp3 | 2022-08-08 21:06 | 4.8M | |
![[SND]](/icons/sound2.gif) | Bro.mp3 | 2022-08-08 21:06 | 5.1M | |
![[SND]](/icons/sound2.gif) | 14 Track14.mp3 | 2022-08-08 21:06 | 0 | |
![[SND]](/icons/sound2.gif) | 16 Track16.mp3 | 2022-08-08 21:06 | 0 | |
![[SND]](/icons/sound2.gif) | Maxxx.mp3 | 2022-08-08 21:06 | 0 | |
![[SND]](/icons/sound2.gif) | ralph1.mp3 | 2022-08-08 21:05 | 0 | |
![[SND]](/icons/sound2.gif) | Max.mp3 | 2022-08-08 21:05 | 136K | |
![[SND]](/icons/sound2.gif) | 07 Track07.mp3 | 2022-08-08 21:05 | 0 | |
![[SND]](/icons/sound2.gif) | 09 Track09.mp3 | 2022-08-08 21:05 | 0 | |
![[SND]](/icons/sound2.gif) | 12 Track12.mp3 | 2022-08-08 21:05 | 0 | |
![[SND]](/icons/sound2.gif) | 10 Track10.mp3 | 2022-08-08 21:04 | 0 | |
![[SND]](/icons/sound2.gif) | 08 Track08.mp3 | 2022-08-08 21:04 | 0 | |
![[SND]](/icons/sound2.gif) | 02 Track02.mp3 | 2022-08-08 21:04 | 0 | |
![[SND]](/icons/sound2.gif) | 05 Track05.mp3 | 2022-08-08 21:03 | 0 | |
![[SND]](/icons/sound2.gif) | 03 Track03.mp3 | 2022-08-08 21:03 | 0 | |
![[SND]](/icons/sound2.gif) | 01 Track01.mp3 | 2022-08-08 21:03 | 0 | |
![[SND]](/icons/sound2.gif) | 04 Track04.mp3 | 2022-08-08 21:02 | 0 | |
![[SND]](/icons/sound2.gif) | 06 Track06.mp3 | 2022-08-08 21:02 | 0 | |
![[SND]](/icons/sound2.gif) | 01 CD 1 Track 1- Das Känguru Von Gegenüber.mp3 | 2022-08-08 21:01 | 0 | |
![[SND]](/icons/sound2.gif) | Abc2.mp3 | 2022-08-08 20:57 | 0 | |
![[SND]](/icons/sound2.gif) | Abc.mp3 | 2022-08-08 20:53 | 0 | |
![[SND]](/icons/sound2.gif) | haz.mp3 | 2022-08-08 20:50 | 0 | |
![[SND]](/icons/sound2.gif) | h8-hood-phantom-mp3.mp3 | 2022-08-08 20:46 | 0 | |
![[SND]](/icons/sound2.gif) | Виктор Цой - Перемен Phonk Edition (mp3-2020.com).mp3 | 2022-08-08 20:45 | 2.3M | |
![[SND]](/icons/sound2.gif) | tian3.mp3 | 2022-08-08 20:44 | 0 | |
![[SND]](/icons/sound2.gif) | tian4.mp3 | 2022-08-08 20:43 | 0 | |
![[SND]](/icons/sound2.gif) | RAINING.mp3 | 2022-08-08 20:40 | 0 | |
![[SND]](/icons/sound2.gif) | Колибри.mp3 | 2022-08-08 20:36 | 0 | |
![[SND]](/icons/sound2.gif) | Hensonn_-_Omega_(musmore.com).mp3 | 2022-08-08 20:31 | 0 | |
![[SND]](/icons/sound2.gif) | чёрные глаза (Kanatbek Remix.mp3 | 2022-08-08 20:29 | 0 | |
![[SND]](/icons/sound2.gif) | xxxmanera_-_Never_Broke_Again_(musmore.com).mp3 | 2022-08-08 20:21 | 0 | |
![[SND]](/icons/sound2.gif) | YAMAUGLI_-_TARANTINO_69906617.mp3 | 2022-08-08 20:20 | 0 | |
![[SND]](/icons/sound2.gif) | Ghostemane - Blood Oceans (ft. Pharaoh).mp3 | 2022-08-08 20:19 | 0 | |
![[SND]](/icons/sound2.gif) | U.mp3 | 2022-08-08 20:18 | 0 | |
![[SND]](/icons/sound2.gif) | S.mp3 | 2022-08-08 20:18 | 0 | |
![[SND]](/icons/sound2.gif) | G.mp3 | 2022-08-08 20:18 | 2.1M | |
![[SND]](/icons/sound2.gif) | jambrut ultah.mp3 | 2022-08-08 20:17 | 938K | |
![[SND]](/icons/sound2.gif) | Ветер.mp3 | 2022-08-08 20:12 | 0 | |
![[SND]](/icons/sound2.gif) | SnapSave.io - Wind (128 kbps).mp3 | 2022-08-08 20:09 | 0 | |
![[SND]](/icons/sound2.gif) | 99sido.mp3 | 2022-08-08 20:08 | 0 | |
![[VID]](/icons/movie.gif) | Killa.mp4 | 2022-08-08 20:07 | 0 | |
![[VID]](/icons/movie.gif) | Wind.mp4 | 2022-08-08 20:07 | 0 | |
![[SND]](/icons/sound2.gif) | Killa.mp3 | 2022-08-08 20:03 | 0 | |
![[SND]](/icons/sound2.gif) | wind.mp3 | 2022-08-08 20:03 | 0 | |
![[SND]](/icons/sound2.gif) | Killer8055.mp3 | 2022-08-08 20:01 | 0 | |
![[SND]](/icons/sound2.gif) | A.L.A - LVL 10 (Official Video).mp3 | 2022-08-08 20:00 | 0 | |
![[SND]](/icons/sound2.gif) | Akeboshi - wind.mp3 | 2022-08-08 19:59 | 0 | |
![[SND]](/icons/sound2.gif) | Sido9.mp3 | 2022-08-08 19:57 | 0 | |
![[SND]](/icons/sound2.gif) | pentap2.mp3 | 2022-08-08 19:57 | 0 | |
![[SND]](/icons/sound2.gif) | SIDO99.mp3 | 2022-08-08 19:56 | 0 | |
![[SND]](/icons/sound2.gif) | pentap1.mp3 | 2022-08-08 19:55 | 0 | |
![[SND]](/icons/sound2.gif) | penta6.mp3 | 2022-08-08 19:53 | 0 | |
![[SND]](/icons/sound2.gif) | penta8.mp3 | 2022-08-08 19:53 | 0 | |
![[SND]](/icons/sound2.gif) | penta9.mp3 | 2022-08-08 19:53 | 0 | |
![[SND]](/icons/sound2.gif) | penta7.mp3 | 2022-08-08 19:53 | 0 | |
![[SND]](/icons/sound2.gif) | penta4.mp3 | 2022-08-08 19:53 | 252K | |
![[SND]](/icons/sound2.gif) | penta5.mp3 | 2022-08-08 19:53 | 0 | |
![[SND]](/icons/sound2.gif) | penta3.mp3 | 2022-08-08 19:52 | 0 | |
![[SND]](/icons/sound2.gif) | Nintendo - Mama ama criminal.mp3 | 2022-08-08 19:52 | 0 | |
![[SND]](/icons/sound2.gif) | dewa16.mp3 | 2022-08-08 19:51 | 0 | |
![[SND]](/icons/sound2.gif) | dewa14.mp3 | 2022-08-08 19:51 | 0 | |
![[SND]](/icons/sound2.gif) | dewa13.mp3 | 2022-08-08 19:51 | 0 | |
![[SND]](/icons/sound2.gif) | dewa15.mp3 | 2022-08-08 19:51 | 0 | |
![[SND]](/icons/sound2.gif) | penta1.mp3 | 2022-08-08 19:51 | 0 | |
![[SND]](/icons/sound2.gif) | penta2.mp3 | 2022-08-08 19:51 | 0 | |
![[SND]](/icons/sound2.gif) | dewa8.mp3 | 2022-08-08 19:49 | 3.3M | |
![[SND]](/icons/sound2.gif) | dewa11.mp3 | 2022-08-08 19:49 | 0 | |
![[SND]](/icons/sound2.gif) | dewa12.mp3 | 2022-08-08 19:49 | 0 | |
![[SND]](/icons/sound2.gif) | dewa7.mp3 | 2022-08-08 19:49 | 0 | |
![[SND]](/icons/sound2.gif) | dewa10.mp3 | 2022-08-08 19:49 | 0 | |
![[SND]](/icons/sound2.gif) | MAKAVELIGODD, Haarper, Baker Ya Maker - Reaper Death Seal.mp3 | 2022-08-08 19:46 | 0 | |
![[SND]](/icons/sound2.gif) | FOVLA - BRODYAGA [6SIX].mp3 | 2022-08-08 19:45 | 0 | |
![[SND]](/icons/sound2.gif) | nong85544aom.mp3 | 2022-08-08 19:45 | 0 | |
![[SND]](/icons/sound2.gif) | Lil Wretched, polyGOD, Baker Ya Maker - SOUTHERN SAVIORS.mp3 | 2022-08-08 19:44 | 0 | |
![[SND]](/icons/sound2.gif) | SLKillinOnDemand.mp3 | 2022-08-08 19:43 | 0 | |
![[SND]](/icons/sound2.gif) | Dita Redrum - FOLLOW THE NIGHT.mp3 | 2022-08-08 19:42 | 0 | |
![[SND]](/icons/sound2.gif) | CAIN - RVN THE MOON.mp3 | 2022-08-08 19:41 | 7.4M | |
![[SND]](/icons/sound2.gif) | SL - Killin' On Demand.mp3 | 2022-08-08 19:40 | 0 | |
![[SND]](/icons/sound2.gif) | LOMEO.mp3 | 2022-08-08 19:38 | 0 | |
![[SND]](/icons/sound2.gif) | xcho-i-can-fly.mp3 | 2022-08-08 19:38 | 0 | |
![[SND]](/icons/sound2.gif) | Miyagi_-_Samurajj_(musmore.com).mp3 | 2022-08-08 19:37 | 0 | |
![[SND]](/icons/sound2.gif) | xcho-feat-macan-memories.mp3 | 2022-08-08 19:37 | 0 | |
![[SND]](/icons/sound2.gif) | xcho-gangster.mp3 | 2022-08-08 19:37 | 0 | |
![[SND]](/icons/sound2.gif) | hity-2020-miyagi-amp-andy-panda-kosandra(mp3mir.ru) (1) - копия.mp3 | 2022-08-08 19:37 | 0 | |
![[SND]](/icons/sound2.gif) | miyagi-amp-andy-panda-tam-reveli-gory(mp3mir.ru).mp3 | 2022-08-08 19:37 | 0 | |
![[SND]](/icons/sound2.gif) | xcho-listok.mp3 | 2022-08-08 19:37 | 0 | |
![[SND]](/icons/sound2.gif) | miyagi-amp-andy-panda-minor(mp3mir.ru).mp3 | 2022-08-08 19:37 | 0 | |
![[SND]](/icons/sound2.gif) | hity-2020-miyagi-amp-andy-panda-kosandra(mp3mir.ru) (1).mp3 | 2022-08-08 19:37 | 0 | |
![[SND]](/icons/sound2.gif) | Jamik_-_Rodnojj_dom_(musmore.com).mp3 | 2022-08-08 19:36 | 0 | |
![[SND]](/icons/sound2.gif) | Jamik - Авторитеты.mp3 | 2022-08-08 19:36 | 0 | |
![[SND]](/icons/sound2.gif) | Jamik - Не Побывал.mp3 | 2022-08-08 19:36 | 0 | |
![[SND]](/icons/sound2.gif) | Jamik - Не Просто.mp3 | 2022-08-08 19:36 | 0 | |
![[SND]](/icons/sound2.gif) | Jamik - Май.mp3 | 2022-08-08 19:36 | 0 | |
![[SND]](/icons/sound2.gif) | Jamik - Молили Небеса.mp3 | 2022-08-08 19:36 | 0 | |
![[SND]](/icons/sound2.gif) | Rustam_Abrekov_Solnce_vshodit_i_zahodit_a_v_moej_tyurme_temno_remiks.mp3 | 2022-08-08 19:36 | 0 | |
![[SND]](/icons/sound2.gif) | PPZ.mp3 | 2022-08-08 19:31 | 0 | |
![[VID]](/icons/movie.gif) | SnapTik_7128737615418772762.mp4 | 2022-08-08 19:27 | 0 | |
![[SND]](/icons/sound2.gif) | VotreDésirEstVotreOrdre_CD09.mp3 | 2022-08-08 19:19 | 0 | |
![[SND]](/icons/sound2.gif) | VotreDésirEstVotreOrdre_CD10.mp3 | 2022-08-08 19:19 | 0 | |
![[SND]](/icons/sound2.gif) | VotreDésirEstVotreOrdre_CD13.mp3 | 2022-08-08 19:18 | 0 | |
![[SND]](/icons/sound2.gif) | VotreDésirEstVotreOrdre_CD14.mp3 | 2022-08-08 19:18 | 0 | |
![[SND]](/icons/sound2.gif) | VotreDésirEstVotreOrdre_CD12.mp3 | 2022-08-08 19:18 | 0 | |
![[SND]](/icons/sound2.gif) | LiSA - Akeboshi -TV ver._(MP3Ball.ru).mp3 | 2022-08-08 19:17 | 0 | |
![[SND]](/icons/sound2.gif) | Kendrick_Lamar_MC_Eiht_-_mAAd_city_48211143.mp3 | 2022-08-08 19:17 | 0 | |
![[SND]](/icons/sound2.gif) | Sektor_Gaza_-_Bomzh_55189317.mp3 | 2022-08-08 19:16 | 0 | |
![[SND]](/icons/sound2.gif) | Samuel Kim Music - Demon Slayer_ Akeboshi (LiSA) x Rengoku vs Akaza Theme EPIC VERSION (Mugen Train OP).mp3 | 2022-08-08 19:16 | 0 | |
![[SND]](/icons/sound2.gif) | GIN Niveau 01 Allemagne 1a.mp3 | 2022-08-08 19:15 | 0 | |
![[SND]](/icons/sound2.gif) | GIN Niveau 01 Allemagne 1c.mp3 | 2022-08-08 19:15 | 0 | |
![[SND]](/icons/sound2.gif) | GIN Niveau 01 Allemagne 1b.mp3 | 2022-08-08 19:15 | 0 | |
![[SND]](/icons/sound2.gif) | GIN Niveau 01 Allemagne 1d.mp3 | 2022-08-08 19:15 | 0 | |
![[SND]](/icons/sound2.gif) | GIN Niveau 01 Zurich 1b.mp3 | 2022-08-08 19:15 | 0 | |
![[SND]](/icons/sound2.gif) | GIN Niveau 01 Zurich 1a.mp3 | 2022-08-08 19:15 | 0 | |
![[SND]](/icons/sound2.gif) | GIN Niveau 01 Zurich 1c.mp3 | 2022-08-08 19:14 | 0 | |
![[SND]](/icons/sound2.gif) | GIN_Niveau_1_Patton_sur_l-art_de_diriger_03.mp3 | 2022-08-08 19:14 | 0 | |
![[SND]](/icons/sound2.gif) | GIN_Niveau_1_Patton_sur_l-art_de_diriger_02.mp3 | 2022-08-08 19:14 | 0 | |
![[SND]](/icons/sound2.gif) | GIN_Niveau_1_Patton_sur_l-art_de_diriger_04.mp3 | 2022-08-08 19:14 | 0 | |
![[SND]](/icons/sound2.gif) | KTS 1-2.mp3 | 2022-08-08 19:14 | 0 | |
![[SND]](/icons/sound2.gif) | KTS 1-1.mp3 | 2022-08-08 19:14 | 0 | |
![[SND]](/icons/sound2.gif) | KTS 2-1.mp3 | 2022-08-08 19:13 | 0 | |
![[SND]](/icons/sound2.gif) | KTS 2-2.mp3 | 2022-08-08 19:13 | 0 | |
![[SND]](/icons/sound2.gif) | KTS 3-1.mp3 | 2022-08-08 19:13 | 0 | |
![[SND]](/icons/sound2.gif) | LiSA_-_Akeboshi_Demon_Slayer_Mugen_Train_OP_(BiffHard.click).mp3 | 2022-08-08 19:11 | 0 | |
![[SND]](/icons/sound2.gif) | pesnya-a-ya-vse-zhil-tumanami-gorod-byl-obmanom.mp3 | 2022-08-08 19:11 | 0 | |
![[SND]](/icons/sound2.gif) | lv_0_20220808215941.mp3 | 2022-08-08 19:10 | 1.0M | |
![[SND]](/icons/sound2.gif) | fabdou.mp3 | 2022-08-08 19:10 | 2.2M | |
![[SND]](/icons/sound2.gif) | dewa5.mp3 | 2022-08-08 19:09 | 4.8M | |
![[SND]](/icons/sound2.gif) | dewa6.mp3 | 2022-08-08 19:09 | 4.9M | |
![[SND]](/icons/sound2.gif) | dewa4.mp3 | 2022-08-08 19:09 | 4.4M | |
![[SND]](/icons/sound2.gif) | FREEAGAREB.mp3 | 2022-08-08 19:06 | 0 | |
![[SND]](/icons/sound2.gif) | Santiz_Daleko_za_zakatom_my_ya_tyanu_etot_sladkij_dym.mp3 | 2022-08-08 19:04 | 6.4M | |
![[SND]](/icons/sound2.gif) | 2021.11.17_LiSA_-_Akeboshi_-Instrumental-_Akeboshi_Shirogane_(BiffHard.click).mp3 | 2022-08-08 18:59 | 10M | |
![[SND]](/icons/sound2.gif) | dewa3.mp3 | 2022-08-08 18:59 | 3.4M | |
![[SND]](/icons/sound2.gif) | dewa2.mp3 | 2022-08-08 18:58 | 3.7M | |
![[SND]](/icons/sound2.gif) | VitalyaBrawlStars.mp3 | 2022-08-08 18:58 | 0 | |
![[SND]](/icons/sound2.gif) | dewa1.mp3 | 2022-08-08 18:56 | 5.1M | |
![[SND]](/icons/sound2.gif) | eto-novyi-bravl-stars.mp3 | 2022-08-08 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | DR_VODKA_KOKAINA.mp3 | 2022-08-08 18:54 | 0 | |
![[SND]](/icons/sound2.gif) | AUD-20220719-WA0002.mp3 | 2022-08-08 18:54 | 1.3M | |
![[SND]](/icons/sound2.gif) | Kobo1.mp3 | 2022-08-08 18:54 | 369K | |
![[SND]](/icons/sound2.gif) | LiSA — Akeboshi (OST Клинок рассекающий демонов Demon Slayer Kimetsu no Yaiba Movie_ Mugen Ressha-hen) (www.lightaudio.ru).mp3 | 2022-08-08 18:53 | 0 | |
![[SND]](/icons/sound2.gif) | LiSA_-_Akeboshi_73333662 (1).mp3 | 2022-08-08 18:52 | 0 | |
![[SND]](/icons/sound2.gif) | name.mp3 | 2022-08-08 18:51 | 2.6M | |
![[SND]](/icons/sound2.gif) | baji.mp3 | 2022-08-08 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | NYU_-_Nikto_73298145.mp3 | 2022-08-08 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | ice.mp3 | 2022-08-08 18:50 | 0 | |
![[SND]](/icons/sound2.gif) | LiSA_-_Akeboshi_73333662.mp3 | 2022-08-08 18:44 | 0 | |
![[SND]](/icons/sound2.gif) | yad_dobra_-_dzhaman_(feat._marcus_tenshi)_muzati.net.mp3 | 2022-08-08 18:43 | 0 | |
![[SND]](/icons/sound2.gif) | LiSA - Akeboshi.mp3 | 2022-08-08 18:42 | 0 | |
![[SND]](/icons/sound2.gif) | mlk1.mp3 | 2022-08-08 18:41 | 0 | |
![[SND]](/icons/sound2.gif) | LiSA_-_Akeboshi_(musmore.com).mp3 | 2022-08-08 18:41 | 0 | |
![[SND]](/icons/sound2.gif) | azashin.mp3 | 2022-08-08 18:37 | 0 | |
![[SND]](/icons/sound2.gif) | LiSA-Akeboshi.mp3 | 2022-08-08 18:35 | 0 | |
![[SND]](/icons/sound2.gif) | Galau9.mp3 | 2022-08-08 18:35 | 0 | |
![[SND]](/icons/sound2.gif) | Eyedress - Jealous (1).mp3 | 2022-08-08 18:35 | 4.7M | |
![[SND]](/icons/sound2.gif) | azashin1.mp3 | 2022-08-08 18:34 | 0 | |
![[SND]](/icons/sound2.gif) | Tesr.mp3 | 2022-08-08 18:34 | 0 | |
![[SND]](/icons/sound2.gif) | LiSA_-_Gurenge_(musmore.com).mp3 | 2022-08-08 18:33 | 0 | |
![[SND]](/icons/sound2.gif) | hllgod_granitnoe_izdelie_(muzebra.top).mp3 | 2022-08-08 18:33 | 0 | |
![[SND]](/icons/sound2.gif) | KANDA.mp3 | 2022-08-08 18:32 | 0 | |
![[SND]](/icons/sound2.gif) | SODA_LUV_-_Bljess_gad_72465406.mp3 | 2022-08-08 18:30 | 5.9M | |
![[SND]](/icons/sound2.gif) | You2.mp3 | 2022-08-08 18:27 | 0 | |
![[SND]](/icons/sound2.gif) | o re piya lutu.mp3 | 2022-08-08 18:27 | 0 | |
![[SND]](/icons/sound2.gif) | Malaak.mp3 | 2022-08-08 18:25 | 0 | |
![[SND]](/icons/sound2.gif) | DINDA.mp3 | 2022-08-08 18:23 | 0 | |
![[SND]](/icons/sound2.gif) | KRBK - 24.mp3 | 2022-08-08 18:21 | 0 | |
![[SND]](/icons/sound2.gif) | Dinda.mp3 | 2022-08-08 18:15 | 0 | |
![[SND]](/icons/sound2.gif) | You.mp3 | 2022-08-08 18:11 | 2.1M | |
![[SND]](/icons/sound2.gif) | autdrp.mp3 | 2022-08-08 18:09 | 0 | |
![[SND]](/icons/sound2.gif) | The Beach.mp3 | 2022-08-08 17:59 | 3.5M | |
![[SND]](/icons/sound2.gif) | Ineedyourmachinegun.mp3 | 2022-08-08 17:57 | 0 | |
![[SND]](/icons/sound2.gif) | I need your machine gun.mp3 | 2022-08-08 17:56 | 0 | |
![[SND]](/icons/sound2.gif) | kv.mp3 | 2022-08-08 17:56 | 0 | |
![[SND]](/icons/sound2.gif) | Sound_Yang_Lagi_Viral_Di_Tiktok_RIZKI._SZ!!!_Dj_Jang_-_Oon_B_(Bootleg)_-_[Raka_Remixer_FT_Dj_Prolal](256k).mp3 | 2022-08-08 17:54 | 0 | |
![[SND]](/icons/sound2.gif) | AUD-20220804-WA0052.mp3 | 2022-08-08 17:53 | 0 | |
![[SND]](/icons/sound2.gif) | SOUND_VIRAL_TIKTOK!!!_Dj_Mojang_Priangan_Mengkane_(Bootleg)(256k).mp3 | 2022-08-08 17:53 | 0 | |
![[SND]](/icons/sound2.gif) | Sound_Yang_Lagi_Viral_Di_TikTok_Rizki.Sz!!!_Dj_Midua_Cinta_Mengkane!!!_(Bootleg)_-_Raka_Remixer(256k).mp3 | 2022-08-08 17:51 | 0 | |
![[SND]](/icons/sound2.gif) | Ollu.mp3 | 2022-08-08 17:50 | 0 | |
![[SND]](/icons/sound2.gif) | fox6.mp3 | 2022-08-08 17:49 | 0 | |
![[SND]](/icons/sound2.gif) | Vald PAM PAM PAM.mp3 | 2022-08-08 17:48 | 0 | |
![[SND]](/icons/sound2.gif) | lui5.mp3.mp3 | 2022-08-08 17:48 | 0 | |
![[SND]](/icons/sound2.gif) | anna-sedokova-shantaram(mp3gid.me).mp3 | 2022-08-08 17:48 | 0 | |
![[SND]](/icons/sound2.gif) | sn.mp3 | 2022-08-08 17:45 | 0 | |
![[SND]](/icons/sound2.gif) | original sound - valorantforge.store_1659980472_musicaldown.com.mp3 | 2022-08-08 17:45 | 0 | |
![[SND]](/icons/sound2.gif) | MORGENSHTERN_Aarne_-_DALEKO_74571235.mp3 | 2022-08-08 17:44 | 5.7M | |
![[SND]](/icons/sound2.gif) | snte20.mp3 | 2022-08-08 17:43 | 0 | |
![[SND]](/icons/sound2.gif) | snte23.mp3 | 2022-08-08 17:43 | 0 | |
![[SND]](/icons/sound2.gif) | snte22.mp3 | 2022-08-08 17:43 | 0 | |
![[SND]](/icons/sound2.gif) | snte21.mp3 | 2022-08-08 17:43 | 0 | |
![[SND]](/icons/sound2.gif) | snte18.mp3 | 2022-08-08 17:43 | 0 | |
![[SND]](/icons/sound2.gif) | LP2022MEGAMIX-demo.mp3 | 2022-08-08 17:43 | 0 | |
![[SND]](/icons/sound2.gif) | MengunduH.mp3 | 2022-08-08 17:40 | 0 | |
![[SND]](/icons/sound2.gif) | KemalPaklepi.mp3 | 2022-08-08 17:37 | 0 | |
![[SND]](/icons/sound2.gif) | Fenn6.mp3 | 2022-08-08 17:34 | 0 | |
![[SND]](/icons/sound2.gif) | SipalingHamil.mp3 | 2022-08-08 17:32 | 0 | |
![[SND]](/icons/sound2.gif) | MomSetahe.mp3 | 2022-08-08 17:30 | 0 | |
![[SND]](/icons/sound2.gif) | Wreireto.mp3 | 2022-08-08 17:29 | 0 | |
![[SND]](/icons/sound2.gif) | AyunaLayangan.mp3 | 2022-08-08 17:29 | 0 | |
![[SND]](/icons/sound2.gif) | 24 - Blues+Shuffle+in+A.mp3 | 2022-08-08 17:27 | 0 | |
![[SND]](/icons/sound2.gif) | icalSad.mp3 | 2022-08-08 17:27 | 0 | |
![[SND]](/icons/sound2.gif) | 01 Inspirabeat.mp3 | 2022-08-08 17:24 | 0 | |
![[SND]](/icons/sound2.gif) | raider1.mp3 | 2022-08-08 17:24 | 0 | |
![[SND]](/icons/sound2.gif) | Dheera (1).mp3 | 2022-08-08 17:24 | 0 | |
![[SND]](/icons/sound2.gif) | 06 Almost Lover.mp3 | 2022-08-08 17:23 | 0 | |
![[SND]](/icons/sound2.gif) | Slow4.mp3 | 2022-08-08 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | Slow2.mp3 | 2022-08-08 17:19 | 0 | |
![[SND]](/icons/sound2.gif) | Slow1.mp3 | 2022-08-08 17:19 | 0 | |
![[SND]](/icons/sound2.gif) | AND.mp3 | 2022-08-08 17:18 | 0 | |
![[SND]](/icons/sound2.gif) | raider2.mp3 | 2022-08-08 17:17 | 0 | |
![[SND]](/icons/sound2.gif) | raider3.mp3 | 2022-08-08 17:16 | 0 | |
![[SND]](/icons/sound2.gif) | Dark Royalty Core Classical Music.mp3 | 2022-08-08 17:16 | 0 | |
![[SND]](/icons/sound2.gif) | jojii.mp3 | 2022-08-08 17:14 | 0 | |
![[SND]](/icons/sound2.gif) | Dying Light 2 Stay Human OST Soundtrack 2 There is Hope.mp3 | 2022-08-08 17:13 | 0 | |
![[SND]](/icons/sound2.gif) | Barat5.mp3 | 2022-08-08 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - you make me strongOne direction Speed upaudio edit Viral Tiktok.mp3 | 2022-08-08 17:00 | 0 | |
![[SND]](/icons/sound2.gif) | dj enak.mp3 | 2022-08-08 16:59 | 2.6M | |
![[SND]](/icons/sound2.gif) | 1603828375_pesnya_barmane_baba_.mp3 | 2022-08-08 16:58 | 0 | |
![[SND]](/icons/sound2.gif) | song free fire max makin hd (BUENAMUSICA.NET).mp3 | 2022-08-08 16:55 | 0 | |
![[SND]](/icons/sound2.gif) | LOVEE.mp3 | 2022-08-08 16:51 | 0 | |
![[SND]](/icons/sound2.gif) | Jancuk1.mp3 | 2022-08-08 16:50 | 0 | |
![[SND]](/icons/sound2.gif) | Testt.mp3 | 2022-08-08 16:50 | 0 | |
![[SND]](/icons/sound2.gif) | IND.mp3 | 2022-08-08 16:48 | 3.6M | |
![[SND]](/icons/sound2.gif) | BRM.mp3 | 2022-08-08 16:44 | 0 | |
![[SND]](/icons/sound2.gif) | Mareux — The Perfect Girl (www.lightaudio.ru) (1).mp3 | 2022-08-08 16:43 | 0 | |
![[SND]](/icons/sound2.gif) | Gw1.mp3 | 2022-08-08 16:42 | 0 | |
![[SND]](/icons/sound2.gif) | Via Amilcare Cucchini.m4a | 2022-08-08 16:42 | 0 | |
![[SND]](/icons/sound2.gif) | Tipo.mp3 | 2022-08-08 16:42 | 0 | |
![[SND]](/icons/sound2.gif) | Jancuk.mp3 | 2022-08-08 16:41 | 2.1M | |
![[SND]](/icons/sound2.gif) | yanto.mp3 | 2022-08-08 16:41 | 3.0M | |
![[SND]](/icons/sound2.gif) | AZIZOS____KIMA_CHAFCHA_(Clip_Officiel)(MP3_70K).mp3 | 2022-08-08 16:41 | 0 | |
![[SND]](/icons/sound2.gif) | Mareux — The Perfect Girl (www.lightaudio.ru).mp3 | 2022-08-08 16:40 | 0 | |
![[SND]](/icons/sound2.gif) | kv2.mp3 | 2022-08-08 16:40 | 0 | |
![[SND]](/icons/sound2.gif) | Zary.mp3 | 2022-08-08 16:37 | 0 | |
![[SND]](/icons/sound2.gif) | bentuk_cinta.mp3 | 2022-08-08 16:36 | 0 | |
![[SND]](/icons/sound2.gif) | Zara.mp3 | 2022-08-08 16:34 | 0 | |
![[SND]](/icons/sound2.gif) | D42 - Lannert - Mist der Typ hat eine Kamera vorm Haus.mp3 | 2022-08-08 16:34 | 0 | |
![[SND]](/icons/sound2.gif) | League of Legends & Mako - Piercing Light.mp3 | 2022-08-08 16:31 | 0 | |
![[SND]](/icons/sound2.gif) | IIRP.mp3 | 2022-08-08 16:28 | 0 | |
![[SND]](/icons/sound2.gif) | 06082022.mp3 | 2022-08-08 16:26 | 0 | |
![[SND]](/icons/sound2.gif) | -- _ قلب المرأة يوسع بس لشخص واحد(MP3_128K).mp3 | 2022-08-08 16:23 | 0 | |
![[SND]](/icons/sound2.gif) | Said Energizer - Chicki.mp3 | 2022-08-08 16:23 | 0 | |
![[SND]](/icons/sound2.gif) | boki13.mp3 | 2022-08-08 16:23 | 0 | |
![[SND]](/icons/sound2.gif) | SandStorm-Portwave - Shadow Lady -phonk--kissvk.com.mp3 | 2022-08-08 16:22 | 0 | |
![[SND]](/icons/sound2.gif) | utopia.mp3 | 2022-08-08 16:15 | 0 | |
![[SND]](/icons/sound2.gif) | VinKy7.mp3 | 2022-08-08 16:10 | 3.5M | |
![[SND]](/icons/sound2.gif) | AUD-20220808-WA0008.mp3 | 2022-08-08 15:58 | 0 | |
![[SND]](/icons/sound2.gif) | Miyagi & Эндшпиль feat. Рем Дигга - I Got Love.mp3 | 2022-08-08 15:54 | 0 | |
![[SND]](/icons/sound2.gif) | Two Two Two - Video Song _ Kaathuvaakula Rendu Kaadhal _ Vijay Sethupathi _ Anirudh _ Vignesh Shivan.mp3 | 2022-08-08 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | Exit.mp3 | 2022-08-08 15:41 | 0 | |
![[SND]](/icons/sound2.gif) | BMW.mp3 | 2022-08-08 15:40 | 2.6M | |
![[SND]](/icons/sound2.gif) | dodol.mp3 | 2022-08-08 15:38 | 3.7M | |
![[SND]](/icons/sound2.gif) | before-you-go-lyrics.mp3 | 2022-08-08 15:35 | 3.2M | |
![[SND]](/icons/sound2.gif) | bod.mp3 | 2022-08-08 15:33 | 0 | |
![[SND]](/icons/sound2.gif) | lucetod2.mp3 | 2022-08-08 15:30 | 952K | |
![[SND]](/icons/sound2.gif) | ms13v20.mp3 | 2022-08-08 15:29 | 0 | |
![[SND]](/icons/sound2.gif) | Layar2.mp3 | 2022-08-08 15:27 | 4.0M | |
![[SND]](/icons/sound2.gif) | Com7.mp3 | 2022-08-08 15:27 | 5.0M | |
![[SND]](/icons/sound2.gif) | lucetod1.mp3 | 2022-08-08 15:26 | 0 | |
![[SND]](/icons/sound2.gif) | Ton1.mp3 | 2022-08-08 15:25 | 0 | |
![[SND]](/icons/sound2.gif) | RFiYou.mp3 | 2022-08-08 15:25 | 0 | |
![[SND]](/icons/sound2.gif) | Battle for Camelot.mp3 | 2022-08-08 15:23 | 0 | |
![[SND]](/icons/sound2.gif) | van1.mp3 | 2022-08-08 15:22 | 1.7M | |
![[SND]](/icons/sound2.gif) | sweetchild.mp3 | 2022-08-08 15:21 | 3.5M | |
![[SND]](/icons/sound2.gif) | Ligaw.mp3 | 2022-08-08 15:21 | 900K | |
![[SND]](/icons/sound2.gif) | ilham6.mp3 | 2022-08-08 15:19 | 2.0M | |
![[SND]](/icons/sound2.gif) | van.mp3 | 2022-08-08 15:19 | 0 | |
![[SND]](/icons/sound2.gif) | HB.mp3 | 2022-08-08 15:18 | 2.9M | |
![[SND]](/icons/sound2.gif) | main1.mp3 | 2022-08-08 15:18 | 0 | |
![[SND]](/icons/sound2.gif) | kiyo6.mp3 | 2022-08-08 15:18 | 0 | |
![[SND]](/icons/sound2.gif) | Ishan10.mp3 | 2022-08-08 15:17 | 0 | |
![[SND]](/icons/sound2.gif) | Kordhell - Killers from northside ringtone __ [ Download link 👇] __ PIXEL BGM.mp3 | 2022-08-08 15:17 | 0 | |
![[SND]](/icons/sound2.gif) | niel1.mp3 | 2022-08-08 15:16 | 0 | |
![[SND]](/icons/sound2.gif) | ilham8.mp3 | 2022-08-08 15:16 | 0 | |
![[SND]](/icons/sound2.gif) | Die For You X บุญผลา (เทสไมค์) Die For you ของ พี่ไมค์ ภิรมย์พร #mashup.mp3 | 2022-08-08 15:15 | 0 | |
![[SND]](/icons/sound2.gif) | [THAISUB] It's You - Ali Gatie.mp3 | 2022-08-08 15:15 | 0 | |
![[SND]](/icons/sound2.gif) | Anam2.mp3 | 2022-08-08 15:13 | 0 | |
![[SND]](/icons/sound2.gif) | 2Pac - Hit 'Em Up (Dirty) (Music Video) HD.mp3 | 2022-08-08 15:06 | 0 | |
![[SND]](/icons/sound2.gif) | Battle Against A True Hero.mp3 | 2022-08-08 15:06 | 0 | |
![[SND]](/icons/sound2.gif) | ถ้าเธอรักใครคนหนึ่ง Ost บุพเพสันนิวาส ๒ เรียนเปียโนง่ายๆโน๊ตตัวใหญ่ดูง่่าย.mp3 | 2022-08-08 15:06 | 3.3M | |
![[SND]](/icons/sound2.gif) | Banyo.mp3 | 2022-08-08 15:05 | 3.3M | |
![[SND]](/icons/sound2.gif) | Dj11.mp3 | 2022-08-08 15:03 | 0 | |
![[SND]](/icons/sound2.gif) | down.mp3 | 2022-08-08 15:03 | 3.2M | |
![[SND]](/icons/sound2.gif) | SICKO MODE.mp3 | 2022-08-08 15:03 | 0 | |
![[SND]](/icons/sound2.gif) | Whish.mp3 | 2022-08-08 15:02 | 0 | |
![[SND]](/icons/sound2.gif) | Anam1.mp3 | 2022-08-08 15:01 | 0 | |
![[SND]](/icons/sound2.gif) | big-baby-tape-kizaru-99-problems-mp3.mp3 | 2022-08-08 15:00 | 6.1M | |
![[SND]](/icons/sound2.gif) | Liam25.mp3 | 2022-08-08 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | Some.mp3 | 2022-08-08 14:52 | 0 | |
![[SND]](/icons/sound2.gif) | Indonesiaraya-gprp.mp3 | 2022-08-08 14:52 | 0 | |
![[SND]](/icons/sound2.gif) | Hall.mp3 | 2022-08-08 14:52 | 0 | |
![[SND]](/icons/sound2.gif) | Andrew.mp3 | 2022-08-08 14:51 | 1.9M | |
![[SND]](/icons/sound2.gif) | once.mp3 | 2022-08-08 14:50 | 5.6M | |
![[SND]](/icons/sound2.gif) | GOU.mp3 | 2022-08-08 14:50 | 816K | |
![[SND]](/icons/sound2.gif) | EMPILIGHT.mp3 | 2022-08-08 14:49 | 3.1M | |
![[SND]](/icons/sound2.gif) | Киря Насваев - Матиз (mp3by.net).mp3 | 2022-08-08 14:48 | 0 | |
![[SND]](/icons/sound2.gif) | FanzMahesa.mp3 | 2022-08-08 14:47 | 0 | |
![[SND]](/icons/sound2.gif) | bugoy.mp3 | 2022-08-08 14:43 | 2.7M | |
![[SND]](/icons/sound2.gif) | AAA.mp3 | 2022-08-08 14:41 | 338K | |
![[SND]](/icons/sound2.gif) | Pu.mp3 | 2022-08-08 14:41 | 0 | |
![[SND]](/icons/sound2.gif) | V1.mp3 | 2022-08-08 14:39 | 0 | |
![[SND]](/icons/sound2.gif) | Dandelions.mp3 | 2022-08-08 14:39 | 4.5M | |
![[SND]](/icons/sound2.gif) | daur - Жалобы.mp3 | 2022-08-08 14:39 | 0 | |
![[SND]](/icons/sound2.gif) | trickster.mp3 | 2022-08-08 14:35 | 2.2M | |
![[SND]](/icons/sound2.gif) | TRICKSTER ANTHEM (Official Music Video).mp3 | 2022-08-08 14:33 | 0 | |
![[SND]](/icons/sound2.gif) | Grammp3.mp3 | 2022-08-08 14:32 | 0 | |
![[SND]](/icons/sound2.gif) | indonesiaraya-glory-pride-roleplay1.mp3 | 2022-08-08 14:32 | 0 | |
![[SND]](/icons/sound2.gif) | Jacky Chang - Pero Atik Ra (Official Music Video).mp3 | 2022-08-08 14:32 | 0 | |
![[SND]](/icons/sound2.gif) | Daur_-_ZHaloby_72782377 (1).mp3 | 2022-08-08 14:31 | 0 | |
![[SND]](/icons/sound2.gif) | sed2.mp3 | 2022-08-08 14:30 | 0 | |
![[SND]](/icons/sound2.gif) | Cd11.mp3 | 2022-08-08 14:27 | 0 | |
![[SND]](/icons/sound2.gif) | TattooIN_-_Vne_sistemy_74518729.mp3 | 2022-08-08 14:27 | 0 | |
![[SND]](/icons/sound2.gif) | indie.mp3 | 2022-08-08 14:26 | 4.8M | |
![[SND]](/icons/sound2.gif) | drums.mp3 | 2022-08-08 14:26 | 0 | |
![[SND]](/icons/sound2.gif) | niel.mp3 | 2022-08-08 14:24 | 2.4M | |
![[SND]](/icons/sound2.gif) | ANAS.mp3 | 2022-08-08 14:24 | 0 | |
![[SND]](/icons/sound2.gif) | Romance.mp3 | 2022-08-08 14:24 | 3.5M | |
![[SND]](/icons/sound2.gif) | hihiha.mp3 | 2022-08-08 14:23 | 0 | |
![[SND]](/icons/sound2.gif) | Ton2.mp3 | 2022-08-08 14:22 | 1.2M | |
![[SND]](/icons/sound2.gif) | Main.mp3 | 2022-08-08 14:22 | 1.7M | |
![[SND]](/icons/sound2.gif) | Mari.mp3 | 2022-08-08 14:21 | 1.3M | |
![[SND]](/icons/sound2.gif) | Dip.mp3 | 2022-08-08 14:21 | 1.2M | |
![[SND]](/icons/sound2.gif) | Ton.mp3 | 2022-08-08 14:21 | 0 | |
![[SND]](/icons/sound2.gif) | Cd1.mp3 | 2022-08-08 14:21 | 0 | |
![[SND]](/icons/sound2.gif) | Djku1.mp3 | 2022-08-08 14:19 | 152K | |
![[SND]](/icons/sound2.gif) | CHABAH1.mp3 | 2022-08-08 14:18 | 4.3M | |
![[SND]](/icons/sound2.gif) | Quasiteilchen (DJ Cannabis Coffeeshops Deutschland).mp3 | 2022-08-08 14:16 | 0 | |
![[SND]](/icons/sound2.gif) | wizykontol.mp3 | 2022-08-08 14:14 | 0 | |
![[SND]](/icons/sound2.gif) | salira.mp3 | 2022-08-08 14:14 | 24K | |
![[SND]](/icons/sound2.gif) | indonesiaraya-glory-pride-roleplay-samp.mp3 | 2022-08-08 14:14 | 0 | |
![[SND]](/icons/sound2.gif) | Jalal El Hamdaoui - La Tenssayna Lyom (Audio 03 - With Lyrics)(MP3_70K) (درجة الصوت 0.44 - سرعة إيقاع 99).mp3 | 2022-08-08 14:14 | 0 | |
![[VID]](/icons/movie.gif) | bandicam 2022-08-08 21-06-43-582.mp4 | 2022-08-08 14:12 | 0 | |
![[SND]](/icons/sound2.gif) | MONS - Lovini(MP3_320K).mp3 | 2022-08-08 14:11 | 0 | |
![[SND]](/icons/sound2.gif) | Antod3.mp3 | 2022-08-08 14:10 | 0 | |
![[SND]](/icons/sound2.gif) | Antod2.mp3 | 2022-08-08 14:10 | 0 | |
![[SND]](/icons/sound2.gif) | Antod1.mp3 | 2022-08-08 14:10 | 0 | |
![[SND]](/icons/sound2.gif) | 15.mp3 | 2022-08-08 14:09 | 1.7M | |
![[SND]](/icons/sound2.gif) | indonesiaraya-glory-pride-roleplay.mp3 | 2022-08-08 14:06 | 0 | |
![[SND]](/icons/sound2.gif) | fdhgsdfhg.mp3 | 2022-08-08 14:05 | 0 | |
![[SND]](/icons/sound2.gif) | PeroAtikRa.mp3 | 2022-08-08 14:04 | 0 | |
![[SND]](/icons/sound2.gif) | Kommunalki_pepelnica_dyrki_v_oboyah_92FLOWERS.mp3 | 2022-08-08 14:02 | 0 | |
![[SND]](/icons/sound2.gif) | 7116127237098818330.mp3 | 2022-08-08 13:58 | 372K | |
![[SND]](/icons/sound2.gif) | 14.mp3 | 2022-08-08 13:56 | 88K | |
![[SND]](/icons/sound2.gif) | Тархун_mz — ГРЕЧА С ХУNЦАМИ (www.lightaudio.ru).mp3 | 2022-08-08 13:56 | 0 | |
![[SND]](/icons/sound2.gif) | nilapakshi.mp3 | 2022-08-08 13:46 | 3.1M | |
![[SND]](/icons/sound2.gif) | Powfu1.mp3 | 2022-08-08 13:46 | 0 | |
![[SND]](/icons/sound2.gif) | DEV1.mp3 | 2022-08-08 13:46 | 0 | |
![[SND]](/icons/sound2.gif) | Ali Ssamid - WALLAH _Official Music Video_ Prod.Valentino(MP3_320K).mp3 | 2022-08-08 13:45 | 0 | |
![[SND]](/icons/sound2.gif) | DEV2.mp3 | 2022-08-08 13:45 | 0 | |
![[SND]](/icons/sound2.gif) | 𝖜𝖊𝖆𝖐𝖓𝖊𝖘𝖘 - Самур.mp3 | 2022-08-08 13:43 | 2.0M | |
![[SND]](/icons/sound2.gif) | SaveTik_Net-dani-sylvia_08-08-22_22-15-41-381.mp3 | 2022-08-08 13:43 | 530K | |
![[SND]](/icons/sound2.gif) | beer.mp3 | 2022-08-08 13:41 | 0 | |
![[SND]](/icons/sound2.gif) | Miyagi and Andy Panda - Патрон_(audiohunter.ru).mp3 | 2022-08-08 13:40 | 0 | |
![[SND]](/icons/sound2.gif) | Miyagi feat. KADI - Родная пой_(audiohunter.ru).mp3 | 2022-08-08 13:38 | 0 | |
![[SND]](/icons/sound2.gif) | Pero Atik Ra - Jacky Chang (Bisaya cover feat. 3RD AVENUE) ♡_ Morissette(MP3_128K).mp3 | 2022-08-08 13:29 | 2.6M | |
![[SND]](/icons/sound2.gif) | Sad2.mp3 | 2022-08-08 13:28 | 888K | |
![[SND]](/icons/sound2.gif) | Pero Atik Ra - Jacky Chang (Bisaya cover feat. 3RD AVENUE) ♡_ Morissette(MP3_160K).mp3 | 2022-08-08 13:22 | 2.1M | |
![[SND]](/icons/sound2.gif) | y2mate.com - Hijau Daun Sesuatu Yang Sempurna Official Video Clip Musik.mp3 | 2022-08-08 13:19 | 0 | |
![[SND]](/icons/sound2.gif) | Sama.mp3 | 2022-08-08 13:18 | 4.7M | |
![[SND]](/icons/sound2.gif) | genit1.mp3 | 2022-08-08 13:07 | 0 | |
![[SND]](/icons/sound2.gif) | FINIK_ALEKS_ATAMAN_-_YUra_SHatunov_74053794.mp3 | 2022-08-08 13:02 | 0 | |
![[SND]](/icons/sound2.gif) | Воскресенский - Плохое поведение.mp3 | 2022-08-08 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | Воскресенский - Девочка.mp3 | 2022-08-08 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | XOLIDAYBOY - ЧЁРНОЕ ВИНО.mp3 | 2022-08-08 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | Sagath feat. HEARTSNOW - По пятам.mp3 | 2022-08-08 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | Sagath feat. HEARTSNOW - По пятам (1).mp3 | 2022-08-08 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | Overlust - Горесть Моя.mp3 | 2022-08-08 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | GGG - MORGENSHTERN Hermit (Bass Gostmane style).mp3 | 2022-08-08 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | Kisah Sempurna - Mahalini Lirik udah di potong.mp3 | 2022-08-08 12:59 | 0 | |
![[SND]](/icons/sound2.gif) | Imagination -Shawn Mendes (lyrics).mp3 | 2022-08-08 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | lamar.mp3 | 2022-08-08 12:51 | 0 | |
![[SND]](/icons/sound2.gif) | kontol.mp3 | 2022-08-08 12:31 | 252K | |
![[SND]](/icons/sound2.gif) | BELI GROUP-Music-productions - BELI GROUP ANTHEM BEAT .m4a | 2022-08-08 12:30 | 0 | |
![[SND]](/icons/sound2.gif) | rsc.mp3 | 2022-08-08 12:30 | 0 | |
![[SND]](/icons/sound2.gif) | VIP121.mp3 | 2022-08-08 12:29 | 0 | |
![[SND]](/icons/sound2.gif) | PL.mp3 | 2022-08-08 12:26 | 2.9M | |
![[SND]](/icons/sound2.gif) | nkeeei-uniqe-artem-shilovets-feat-mayot-u-u-u.mp3 | 2022-08-08 12:25 | 0 | |
![[SND]](/icons/sound2.gif) | gg.mp3 | 2022-08-08 12:25 | 2.8M | |
![[SND]](/icons/sound2.gif) | like.mp3 | 2022-08-08 12:23 | 0 | |
![[SND]](/icons/sound2.gif) | awis.mp3 | 2022-08-08 12:23 | 0 | |
![[SND]](/icons/sound2.gif) | Ezhemesyachnye_-_tolko_po_duri_69601880.mp3 | 2022-08-08 12:23 | 0 | |
![[SND]](/icons/sound2.gif) | Jamie_Bower_-_Paralysed_Live_From_The_Alter[ConverteZilla.com].mp3 | 2022-08-08 12:20 | 0 | |
![[SND]](/icons/sound2.gif) | Merbabu02.mp3 | 2022-08-08 12:18 | 1.4M | |
![[SND]](/icons/sound2.gif) | pantek.mp3 | 2022-08-08 12:17 | 2.0M | |
![[SND]](/icons/sound2.gif) | Dalam-Sepiku-Kaulah-Candaku-Rendy-Andika-ft-Mita-Mpot-Cintaku-DJ-Topeng-Remix_9dzyhPzTIfk.mp3 | 2022-08-08 12:16 | 2.0M | |
![[SND]](/icons/sound2.gif) | paimon1.mp3 | 2022-08-08 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | Cinta.mp3 | 2022-08-08 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | Pengen.mp3 | 2022-08-08 12:09 | 0 | |
![[SND]](/icons/sound2.gif) | LUNAR.mp3 | 2022-08-08 12:08 | 0 | |
![[SND]](/icons/sound2.gif) | viyi.mp3 | 2022-08-08 12:07 | 0 | |
![[SND]](/icons/sound2.gif) | [YT2mp3 (mp3cut.net).mp3 | 2022-08-08 12:07 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1659960016912.mp3 | 2022-08-08 12:03 | 0 | |
![[SND]](/icons/sound2.gif) | Ungol.mp3 | 2022-08-08 12:02 | 1.0M | |
![[SND]](/icons/sound2.gif) | LeftRight.mp3 | 2022-08-08 12:02 | 0 | |
![[SND]](/icons/sound2.gif) | Fefe.mp3 | 2022-08-08 12:01 | 0 | |
![[SND]](/icons/sound2.gif) | Wasted.mp3 | 2022-08-08 12:01 | 0 | |
![[SND]](/icons/sound2.gif) | All Type A Drugs.mp3 | 2022-08-08 11:59 | 0 | |
![[SND]](/icons/sound2.gif) | Gg.mp3 | 2022-08-08 11:59 | 500K | |
![[SND]](/icons/sound2.gif) | RianR1mex.mp3 | 2022-08-08 11:58 | 0 | |
![[SND]](/icons/sound2.gif) | wint.mp3 | 2022-08-08 11:57 | 0 | |
![[SND]](/icons/sound2.gif) | slp.mp3 | 2022-08-08 11:57 | 0 | |
![[SND]](/icons/sound2.gif) | Fallin.mp3 | 2022-08-08 11:57 | 0 | |
![[SND]](/icons/sound2.gif) | TimPogi.mp3 | 2022-08-08 11:56 | 0 | |
![[SND]](/icons/sound2.gif) | JO.mp3 | 2022-08-08 11:51 | 0 | |
![[SND]](/icons/sound2.gif) | Calvin Harris, Dua Lipa - One Kiss (Lyrics).mp3 | 2022-08-08 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | Subway Surfers — Game Theme (www.lightaudio.ru).mp3 | 2022-08-08 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | Subway_Surfers_-_OST_Glavnaya_tema_73599365.mp3 | 2022-08-08 11:49 | 0 | |
![[SND]](/icons/sound2.gif) | Ida Hauan med oppdateringer mandag.mp3 | 2022-08-08 11:48 | 0 | |
![[SND]](/icons/sound2.gif) | WIBOY15.mp3 | 2022-08-08 11:45 | 0 | |
![[SND]](/icons/sound2.gif) | 1555931844_unknown-brain-matafaka-feat_-marvin-divine.mp3 | 2022-08-08 11:43 | 0 | |
![[SND]](/icons/sound2.gif) | angkasa1.mp3 | 2022-08-08 11:42 | 0 | |
![[SND]](/icons/sound2.gif) | Slipknot - Psychosocial.mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | Slipknot - Surfacing.mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | oomb.mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | Stahlmann - Hass mich.lieb mich.mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | Slipknot - People = Shit (1).mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | Slipknot - (sic).mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | Modjo - Lady (1).mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | Rammstein - DU HAST.mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | Rammstein - Feuer frei.mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | Nervana - Smells Like Teen Spint.mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | 20 Fingers feat. Gillette - Short Dick Man (Club Mix).mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | im so lucky lucky - lucky twice ☆.mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | Bloodhound Gang - I Hope You Die.mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | Fazlija - Helikopter.mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | KSLV Noh - Disaster.mp3 | 2022-08-08 11:34 | 3.2M | |
![[SND]](/icons/sound2.gif) | Black Pug - Seven Nation Army (Metal Cover).mp3 | 2022-08-08 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | GRLwood - Nice Guy.mp3 | 2022-08-08 11:33 | 0 | |
![[SND]](/icons/sound2.gif) | 3-bigg-balls-By-Tuna.mp3 | 2022-08-08 11:33 | 0 | |
![[SND]](/icons/sound2.gif) | ah-hell-nah-By-Tuna.mp3 | 2022-08-08 11:33 | 0 | |
![[SND]](/icons/sound2.gif) | GOTUSO.mp3 | 2022-08-08 11:29 | 0 | |
![[SND]](/icons/sound2.gif) | close.mp3 | 2022-08-08 11:29 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - cover viral Last Child Duka cover bashri.mp3 | 2022-08-08 11:26 | 0 | |
![[SND]](/icons/sound2.gif) | BryanD07.mp3 | 2022-08-08 11:26 | 0 | |
![[SND]](/icons/sound2.gif) | HERO.mp3 | 2022-08-08 11:25 | 3.0M | |
![[SND]](/icons/sound2.gif) | DJ_MIDUA.mp3 | 2022-08-08 11:20 | 0 | |
![[SND]](/icons/sound2.gif) | hot42.mp3 | 2022-08-08 11:17 | 0 | |
![[SND]](/icons/sound2.gif) | hot50.mp3 | 2022-08-08 11:16 | 0 | |
![[SND]](/icons/sound2.gif) | DJMIDUA.mp3 | 2022-08-08 11:16 | 0 | |
![[SND]](/icons/sound2.gif) | nguyenthanhhoang.mp3 | 2022-08-08 11:15 | 0 | |
![[SND]](/icons/sound2.gif) | kelazzz.mp3 | 2022-08-08 11:11 | 0 | |
![[SND]](/icons/sound2.gif) | Dj100.mp3 | 2022-08-08 11:11 | 2.9M | |
![[SND]](/icons/sound2.gif) | the-chainsmokers-feat.-daya-dont-let-me-down.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | gaullin-moonlight.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | Rakhim - Fendi.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | the-chainsmokers-coldplay-something-just-like-this.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | ed-sheeran-shape-of-you.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | mozgi-poljubje.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | Big_Baby_Tape_Arut_Vlaga.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | I_tried_so_hard_(ringon.site).mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | MACAN_Kino.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | dabro-ja-po-chasticam.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | topic-feat.-a7s-breaking-me.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | sia-chandelier.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | tiesto-sevenn-boom.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | Unknown Brain - Superhero (feat. Chris Linton)_(muzfan.net).mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | gaullin-julian-perretta-seven-nation-army.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | Tanir, Tyomcha - Da Da Da.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | tyga_-_ayy_macarena_muzter.net.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | drenchill-feat.-indiiana-freed-from-desire.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | rita-ora-let-you-love-me.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | vera-brezhneva-blizkie-ljudi.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | imagine-dragons-thunder.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | Kaleo_-_Way_down_we_go_(ringon.site).mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | the-chainsmokers-feat.-emily-warren-side-effects.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | tones-and-i-dance-monkey.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | minelli-rampampam.mp3 | 2022-08-08 11:10 | 2.1M | |
![[SND]](/icons/sound2.gif) | Velya_с4.mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | Лауд - My Life My Rules (feat. Boulevard Depo, i61).mp3 | 2022-08-08 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | SEDIH3.mp3 | 2022-08-08 11:09 | 0 | |
![[SND]](/icons/sound2.gif) | My Chemical Romance - I'm Not Okay (I Promise) [Dialogue_MTV Version].mp3 | 2022-08-08 11:07 | 0 | |
![[SND]](/icons/sound2.gif) | IERN.mp3 | 2022-08-08 11:06 | 0 | |
![[SND]](/icons/sound2.gif) | SEDIH1.mp3 | 2022-08-08 11:04 | 1.0M | |
![[SND]](/icons/sound2.gif) | Love.mp3 | 2022-08-08 11:04 | 3.9M | |
![[SND]](/icons/sound2.gif) | the-prince-karma-later-bitches.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | the-kid-laroi-feat.-justin-bieber-stay.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | egor-krid-cosmoboy-pubg-mobile-theme-song-file.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | enrique-iglesias-feat.-descemer-bueno-jacob-forever-subeme-la-radio-remix.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | rasa-feat.-kavabanga-depo-kolibri-fioletovo.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | foushee-deep-end-rompasso-remix.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | christina-aguilera-genie-in-a-bottle.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | maksim-fadeev-grigorijj-leps-orly-ili-vorony.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | egor-krid-amp-molly-esli-ty-menja-ne-ljubish.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | trevor-daniel-falling-blackbear-remix.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | Luis Fonsi - Despacito (Version Pop).mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | dnce-feat.-nicki-minaj-kissing-strangers.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | filv-edmofo-feat.-emma-peters-clandestina.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | griby-niga-ne-goni.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | ofenbach-be-mine.mp3 | 2022-08-08 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | NEFFEX_-_Fight-Back.mp3 | 2022-08-08 11:02 | 0 | |
![[SND]](/icons/sound2.gif) | irina-dubcova-fakt.mp3 | 2022-08-08 11:02 | 0 | |
![[SND]](/icons/sound2.gif) | valerijj-meladze-svoboda-ili-sladkijj-plen.mp3 | 2022-08-08 11:02 | 0 | |
![[SND]](/icons/sound2.gif) | 114-AN-NAAS.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 106-QURESH.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 113-AL-FALAQ.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 111-AL-LAHAB.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 112-AL-IKHLAAS.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 105-AL-FEEL.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 104-AL-HUMAZAH.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 109-AL-KAFIROON.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 110-AN-NASR.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 107-AL-MAA'OON.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 108-AL-KAUSER.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 103-AL-ASR.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 101-AL-QAAR'IAH.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 102AT-TAKASUR.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | aziyat.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 084-AL-INSHIQAAQ.mp3 | 2022-08-08 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | 099-AZ-ZILZAAL.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 100-AL-ADIAAT.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 096-AL-ALAQ.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | Tak Ingin Usai – Keisya Levronka (KARAOKE PIANO - FEMALE LOWER KEY).mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 094-AL-INSHIRAH.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 089-AL-FAJR.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 093-AZ-ZUHAA.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 097-Al-QADR.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 095-AT-TEEN.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 087-AL-A'LAA.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 090-AL-BALAD.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 088-AL-GHASHIAH.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 085-AL-BUROOJ.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 083-AL-MUTTAFFIFEEN.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 086-AT-TARIQ.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 079-AN-NAZI'AAT.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 081-AT-TAKWEER.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 064-AT-TAGHABUN.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 082-AL-INFITAAR.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 075-AL-QIYAAMAH.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | Joji.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 076-AD-DAHR.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 065-AT-TALAAQ.mp3 | 2022-08-08 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 072-AL-JINN.mp3 | 2022-08-08 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | 073-AL-MUZZAMMIL.mp3 | 2022-08-08 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | 063-AL-MUNAFIQOON.mp3 | 2022-08-08 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | 071-NOOH.MP.mp3 | 2022-08-08 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | 068-AL-QALAM.mp3 | 2022-08-08 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | 070-AL-MA'ARIJ.mp3 | 2022-08-08 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | 069-AL-HAAQ-QAH.mp3 | 2022-08-08 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | 067-AL-MULK.mp3 | 2022-08-08 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | 066-AT-TAHREEM.mp3 | 2022-08-08 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | 061-AS-SAFF.mp3 | 2022-08-08 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | 062-AL-JUMU'AH.mp3 | 2022-08-08 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | Lil Peep-Runaway.mp3 | 2022-08-08 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | Rp1.mp3 | 2022-08-08 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | GIBO.mp3 | 2022-08-08 10:58 | 0 | |
![[SND]](/icons/sound2.gif) | 057-AL-HADEED.mp3 | 2022-08-08 10:57 | 0 | |
![[SND]](/icons/sound2.gif) | 060-AL-MUMTAHINAH.mp3 | 2022-08-08 10:57 | 0 | |
![[SND]](/icons/sound2.gif) | iChoose.mp3 | 2022-08-08 10:57 | 0 | |
![[SND]](/icons/sound2.gif) | 054-AL-QAMAR.mp3 | 2022-08-08 10:57 | 0 | |
![[SND]](/icons/sound2.gif) | 059-AL-HASHR.mp3 | 2022-08-08 10:57 | 0 | |
![[SND]](/icons/sound2.gif) | 056-AL-WAQI'AH.mp3 | 2022-08-08 10:56 | 0 | |
![[SND]](/icons/sound2.gif) | 055-AR-RAHMAN.mp3 | 2022-08-08 10:56 | 0 | |
![[VID]](/icons/movie.gif) | lil peep x lil tracy - witchblades (Official Video).mp4 | 2022-08-08 10:56 | 0 | |
![[SND]](/icons/sound2.gif) | 051-AZ-ZARIYAAT.mp3 | 2022-08-08 10:55 | 0 | |
![[SND]](/icons/sound2.gif) | 041-HAA MEEM AS-SAJDAH.mp3 | 2022-08-08 10:55 | 0 | |
![[SND]](/icons/sound2.gif) | 043-AZ-ZUKHRUF.mp3 | 2022-08-08 10:55 | 0 | |
![[SND]](/icons/sound2.gif) | 044-AD-DUKHAN.mp3 | 2022-08-08 10:54 | 0 | |
![[SND]](/icons/sound2.gif) | 046-AL-AHQAAF.mp3 | 2022-08-08 10:53 | 0 | |
![[SND]](/icons/sound2.gif) | 033-AL-AHZAB.mp3 | 2022-08-08 10:51 | 0 | |
![[SND]](/icons/sound2.gif) | 040-AL-MO'MIN.mp3 | 2022-08-08 10:51 | 0 | |
![[SND]](/icons/sound2.gif) | 036-YAA SEEN.mp3 | 2022-08-08 10:51 | 0 | |
![[SND]](/icons/sound2.gif) | 038-SUAD.MP.mp3 | 2022-08-08 10:51 | 0 | |
![[SND]](/icons/sound2.gif) | 039-AZ-ZUMAR.mp3 | 2022-08-08 10:51 | 0 | |
![[SND]](/icons/sound2.gif) | 037-AS-SAFFAAT.mp3 | 2022-08-08 10:50 | 0 | |
![[SND]](/icons/sound2.gif) | 031-LUQMAN.mp3 | 2022-08-08 10:50 | 0 | |
![[SND]](/icons/sound2.gif) | 029-AL-ANKABOOT.mp3 | 2022-08-08 10:49 | 0 | |
![[SND]](/icons/sound2.gif) | 030-AR-ROOM.mp3 | 2022-08-08 10:49 | 0 | |
![[SND]](/icons/sound2.gif) | 028-AL-QASES.mp3 | 2022-08-08 10:49 | 0 | |
![[SND]](/icons/sound2.gif) | 025-AL-FURQAN.mp3 | 2022-08-08 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | 024-AN-NOOR.mp3 | 2022-08-08 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | 027-AN-NAML.mp3 | 2022-08-08 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | Y2K & Bbnos - Lalala.mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | RASA - Пчеловод.mp3 | 2022-08-08 10:46 | 6.5M | |
![[SND]](/icons/sound2.gif) | lp-other-people-swanky-tunes-going-deeper-remix.mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | psy-gangnam-style.mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | raye-feat.-rudimental-regardless.mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | mjevl-patamushka.mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | 022-AL-HAJJ.mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | karna-val-psihushka-mp3.mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | majnkraft-evgenbro-ty-ne-mog-ma-ya-smog.mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | kyz9ka - Хаги Ваги.mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | SHOOVAL - Мы открываем бизнес (1).mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | 023-AL-MO'MINOON.mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | Konfuz - Ратата.mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | Slava Marlow - Снова Я Напиваюсь.mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | SLAVA MARLOW - Ты горишь как огонь.mp3 | 2022-08-08 10:46 | 0 | |
![[SND]](/icons/sound2.gif) | Rakhim - Кто Тебе Сказал.mp3 | 2022-08-08 10:45 | 0 | |
![[SND]](/icons/sound2.gif) | The Supremes_ Love Is Like an Itching in My Heart (Holland _ Dozier, 1966) - Lyrics.mp3 | 2022-08-08 10:45 | 0 | |
![[SND]](/icons/sound2.gif) | 019-MARYAM.mp3 | 2022-08-08 10:44 | 0 | |
![[SND]](/icons/sound2.gif) | 020-TAA HAA.mp3 | 2022-08-08 10:43 | 0 | |
![[SND]](/icons/sound2.gif) | DJ SLOW YA CUMA KAMU X YOU MAKE ME FEEL _ VIRAL TIKTOK 2022.mp3 | 2022-08-08 10:42 | 0 | |
![[SND]](/icons/sound2.gif) | Rp.mp3 | 2022-08-08 10:42 | 3.6M | |
![[SND]](/icons/sound2.gif) | 017-BANI ISRAIL [036 TO End].mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | 012-YOUSUF.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | 014-IBRAHEEM.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | 017-BANI ISRAIL [001 TO 035].mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | 016-AN-NAHL [001 TO 065].mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | Веля - с4.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | 016-AN-NAHL [066 TO End].mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | anikdote-turn-it-up_37662143.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | Bag_Raiders_-_Shooting_Stars.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | calvin-harris-sam-smith-promises.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | charlie-puth-attention.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | 1654711070_spvbrtvnkrbl.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | benny-benassi-feat-dhany-hit-my-heart.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | 013-AR-RA'AD.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | 5sta-family-mnogojetazhki.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | Нурминский - Ауфф.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | DaBro - Юность.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | Dava feat. Серёга - Черный Бумер.mp3 | 2022-08-08 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | Тайпан feat. Agunda - Луна Не Знает Пути.mp3 | 2022-08-08 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Сява - Без Повода.mp3 | 2022-08-08 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Нурминский - Валим.mp3 | 2022-08-08 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Lana Del Rey - Burnt Norton (Interlude).mp3 | 2022-08-08 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | 002-AL-BAQARAH (001 TO 029).mp3 | 2022-08-08 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | 002-AL-BAQARAH [229 TO 253].mp3 | 2022-08-08 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | 002-AL-BAQARAH [197 TO 228].mp3 | 2022-08-08 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | 002-AL-BAQARAH [108 TO 141].mp3 | 2022-08-08 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | 002-AL-BAQARAH [177 TO 196].mp3 | 2022-08-08 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | Save.mp3 | 2022-08-08 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | 002-AL-BAQARAH (030 TO 046).mp3 | 2022-08-08 10:37 | 8.1M | |
![[SND]](/icons/sound2.gif) | 002-AL-BAQARAH [142 TO 176].mp3 | 2022-08-08 10:37 | 10M | |
![[SND]](/icons/sound2.gif) | 002-AL-BAQARAH [047 TO 074].mp3 | 2022-08-08 10:37 | 10M | |
![[SND]](/icons/sound2.gif) | 002-AL-BAQARAH [075 TO 107].mp3 | 2022-08-08 10:37 | 10M | |
![[SND]](/icons/sound2.gif) | 001-AL-FAATIHAH.mp3 | 2022-08-08 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | Hal-L-Official-Audio_xAFKlDjKO5o (1).mp3 | 2022-08-08 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | hujan.mp3 | 2022-08-08 10:35 | 1.7M | |
![[SND]](/icons/sound2.gif) | yt5s.io - The Supremes_ Love Is Like an Itching in My Heart (Holland _ Dozier, 1966) - Lyrics (128 kbps).mp3 | 2022-08-08 10:34 | 0 | |
![[SND]](/icons/sound2.gif) | 002-AL-BAQARAH [254 TO End].mp3 | 2022-08-08 10:33 | 0 | |
![[SND]](/icons/sound2.gif) | stars.mp3 | 2022-08-08 10:30 | 0 | |
![[SND]](/icons/sound2.gif) | mulixneed.mp3 | 2022-08-08 10:30 | 0 | |
![[SND]](/icons/sound2.gif) | mashupkago.mp3 | 2022-08-08 10:29 | 0 | |
![[SND]](/icons/sound2.gif) | mashicov.mp3 | 2022-08-08 10:29 | 0 | |
![[SND]](/icons/sound2.gif) | lagimashup.mp3 | 2022-08-08 10:29 | 0 | |
![[SND]](/icons/sound2.gif) | gimelove.mp3 | 2022-08-08 10:29 | 0 | |
![[SND]](/icons/sound2.gif) | castle.mp3 | 2022-08-08 10:29 | 0 | |
![[SND]](/icons/sound2.gif) | byahecover.mp3 | 2022-08-08 10:29 | 0 | |
![[SND]](/icons/sound2.gif) | yt5s.io - Bee Gees - Spirits (Having Flown) (128 kbps).mp3 | 2022-08-08 10:27 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.app - เป็นเกียรติหลาย - มนต์แคน แก่นคูน 【MUSIC VIDEO】 (128 kbps).mp3 | 2022-08-08 10:26 | 940K | |
![[SND]](/icons/sound2.gif) | last_friday_night___TikTok_Version___speed_up____lyrics_.(128k).m4a | 2022-08-08 10:25 | 0 | |
![[SND]](/icons/sound2.gif) | And_so_it_was.mp3 | 2022-08-08 10:25 | 0 | |
![[SND]](/icons/sound2.gif) | SEDIH.mp3 | 2022-08-08 10:19 | 4.0M | |
![[SND]](/icons/sound2.gif) | BYFARID.mp3 | 2022-08-08 10:18 | 0 | |
![[SND]](/icons/sound2.gif) | kakaobelogo (1).mp3 | 2022-08-08 10:16 | 0 | |
![[SND]](/icons/sound2.gif) | Aishite Aishite Aishite (English Cover)【Will Stetson】.mp3 | 2022-08-08 10:13 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ AKU TITIPKAN DIA X SIA SIAKU BERJUANG DIRANTAU ORANG REMIX VIRAL TIKTOK ALBUM 2021 (1).mp3 | 2022-08-08 10:12 | 0 | |
![[SND]](/icons/sound2.gif) | luckyy.mp3 | 2022-08-08 10:12 | 0 | |
![[SND]](/icons/sound2.gif) | 07 Aug 2022 Mix By Veli.mp3 | 2022-08-08 10:11 | 0 | |
![[SND]](/icons/sound2.gif) | Instasamka_-_KHlopajj_Christmas_Tik_Tok_reMix_73378106.mp3 | 2022-08-08 10:08 | 0 | |
![[SND]](/icons/sound2.gif) | lucky.mp3 | 2022-08-08 10:03 | 2.2M | |
![[SND]](/icons/sound2.gif) | never.mp3 | 2022-08-08 09:59 | 1.0M | |
![[SND]](/icons/sound2.gif) | rizky.mp3 | 2022-08-08 09:53 | 4.5M | |
![[SND]](/icons/sound2.gif) | brk1.mp3 | 2022-08-08 09:52 | 0 | |
![[SND]](/icons/sound2.gif) | Alireza-JJ-Sijal-Pir-Shodim-Vali-Bozorg-Na-(Ft-Nassim)-320 (mp3cut.net).mp3 | 2022-08-08 09:50 | 0 | |
![[SND]](/icons/sound2.gif) | tegarganz.mp3 | 2022-08-08 09:49 | 0 | |
![[SND]](/icons/sound2.gif) | Cheb Hasni - aachk jdid.mp3 | 2022-08-08 09:47 | 0 | |
![[SND]](/icons/sound2.gif) | bro1.mp3 | 2022-08-08 09:46 | 0 | |
![[SND]](/icons/sound2.gif) | sikfiling.mp3 | 2022-08-08 09:46 | 0 | |
![[SND]](/icons/sound2.gif) | broker1.mp3 | 2022-08-08 09:44 | 0 | |
![[SND]](/icons/sound2.gif) | bayu1.mp3 | 2022-08-08 09:42 | 3.1M | |
![[SND]](/icons/sound2.gif) | Mackenzie Ziegler - Breathe (Lyrics) _So breathe, like you know you should_.mp3 | 2022-08-08 09:42 | 0 | |
![[SND]](/icons/sound2.gif) | Yums5.mp3 | 2022-08-08 09:41 | 0 | |
![[SND]](/icons/sound2.gif) | Yums4.mp3 | 2022-08-08 09:41 | 0 | |
![[SND]](/icons/sound2.gif) | Yums3.mp3 | 2022-08-08 09:40 | 0 | |
![[SND]](/icons/sound2.gif) | Simpleng Tao Lyrics - Gloc 9.mp3 | 2022-08-08 09:40 | 0 | |
![[SND]](/icons/sound2.gif) | shyrah.mp3 | 2022-08-08 09:40 | 0 | |
![[SND]](/icons/sound2.gif) | yam2.mp3 | 2022-08-08 09:38 | 0 | |
![[SND]](/icons/sound2.gif) | Lontongenak1.mp3 | 2022-08-08 09:34 | 2.7M | |
![[SND]](/icons/sound2.gif) | ram1.mp3 | 2022-08-08 09:33 | 3.3M | |
![[SND]](/icons/sound2.gif) | Pasukan1.mp3 | 2022-08-08 09:32 | 0 | |
![[SND]](/icons/sound2.gif) | dhije100.mp3 | 2022-08-08 09:27 | 0 | |
![[SND]](/icons/sound2.gif) | Yums2.mp3 | 2022-08-08 09:25 | 0 | |
![[SND]](/icons/sound2.gif) | Yums1.mp3 | 2022-08-08 09:22 | 0 | |
![[SND]](/icons/sound2.gif) | Insane.mp3 | 2022-08-08 09:20 | 0 | |
![[SND]](/icons/sound2.gif) | starboy.mp3 | 2022-08-08 09:20 | 0 | |
![[SND]](/icons/sound2.gif) | o5.mp3 | 2022-08-08 09:18 | 4.0M | |
![[SND]](/icons/sound2.gif) | Gloc 9 Greatest Hits Full Album 2020 - Best Of Gloc 9 Nonstop - Gloc 9 Band Greatest Hits (128 kbps).mp3 | 2022-08-08 09:17 | 0 | |
![[SND]](/icons/sound2.gif) | neandro.mp3 | 2022-08-08 09:16 | 1.4M | |
![[SND]](/icons/sound2.gif) | Yo1.mp3 | 2022-08-08 09:14 | 8.2M | |
![[SND]](/icons/sound2.gif) | Bruno Mars - When I Was Your Man (Video Lirik) _ John Legend, Sam Smith,....mp3 | 2022-08-08 09:12 | 488K | |
![[SND]](/icons/sound2.gif) | fugy99.mp3 | 2022-08-08 09:11 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Kevin MacLeod BEST OF Best known music by Kevin MacLeod.mp3.mp3 | 2022-08-08 09:10 | 0 | |
![[SND]](/icons/sound2.gif) | ROAD_DEVILS_MC'S_-_Prod_By_MANGBORIS_(Official_Audio)(128k).mp3 | 2022-08-08 09:08 | 3.2M | |
![[SND]](/icons/sound2.gif) | Peri_Cintaku_-_Ziva_Magnolya_(Lirik_Lagu)_~_TikTok_Viral_Tuhan_memang_satu,_kita_yang_tak_sama..(128k).mp3 | 2022-08-08 09:04 | 4.1M | |
![[SND]](/icons/sound2.gif) | YELLOWEEN_-_TOKIO_x_BASO_x_PAFF_x_EITARO_(Official_Music_Video)(128k).mp3 | 2022-08-08 09:04 | 3.2M | |
![[SND]](/icons/sound2.gif) | HEJOBOYS_(OFFICIAL_MUSIC_VIDEO)(128k).mp3 | 2022-08-08 09:03 | 3.3M | |
![[SND]](/icons/sound2.gif) | GHO_FAM_-_Prod_By._MANGBORIS_(Official_Audio)(128k).mp3 | 2022-08-08 09:03 | 1.9M | |
![[SND]](/icons/sound2.gif) | Ezra4.mp3 | 2022-08-08 09:02 | 5.0M | |
![[SND]](/icons/sound2.gif) | MeerFly_-_%22HAA_TEPOK%22_(Ft._MK_|_K-Clique_&_Kidd_Santhe)_[OFFICIAL_LYRICS_VIDEO](128k).mp3 | 2022-08-08 09:02 | 3.4M | |
![[SND]](/icons/sound2.gif) | rof12.mp3 | 2022-08-08 09:00 | 6.7M | |
![[SND]](/icons/sound2.gif) | Caleb Landry Jones - Im On Top of the World.mp3 | 2022-08-08 09:00 | 3.8M | |
![[SND]](/icons/sound2.gif) | Vp9 .mp3 | 2022-08-08 08:59 | 2.9M | |
![[SND]](/icons/sound2.gif) | ajm.mp3 | 2022-08-08 08:59 | 2.8M | |
![[SND]](/icons/sound2.gif) | Ezra3.mp3 | 2022-08-08 08:57 | 4.9M | |
![[SND]](/icons/sound2.gif) | 6ix9ine-gooba-official-music-video.mp3 | 2022-08-08 08:56 | 0 | |
![[SND]](/icons/sound2.gif) | Caleb Landry Jones - Suckin' Up The Oxygen.mp3 | 2022-08-08 08:54 | 528K | |
![[SND]](/icons/sound2.gif) | phonk1.mp3 | 2022-08-08 08:54 | 2.1M | |
![[SND]](/icons/sound2.gif) | boy1.mp3 | 2022-08-08 08:51 | 0 | |
![[SND]](/icons/sound2.gif) | letter.mp3 | 2022-08-08 08:48 | 2.9M | |
![[SND]](/icons/sound2.gif) | ikaw.mp3 | 2022-08-08 08:48 | 4.0M | |
![[SND]](/icons/sound2.gif) | crad.mp3 | 2022-08-08 08:48 | 0 | |
![[SND]](/icons/sound2.gif) | drugs.mp3 | 2022-08-08 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | humble.mp3 | 2022-08-08 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | todd.mp3 | 2022-08-08 08:42 | 0 | |
![[SND]](/icons/sound2.gif) | Moneyso.mp3 | 2022-08-08 08:41 | 0 | |
![[SND]](/icons/sound2.gif) | abubu.mp3 | 2022-08-08 08:40 | 0 | |
![[SND]](/icons/sound2.gif) | Syava_-_Ne_blatujj_73187272.mp3 | 2022-08-08 08:37 | 0 | |
![[SND]](/icons/sound2.gif) | Syava_-_YA_drochu_kak_ya_khochu_48245395.mp3 | 2022-08-08 08:36 | 0 | |
![[SND]](/icons/sound2.gif) | genjer genjer cu.mp3 | 2022-08-08 08:28 | 0 | |
![[SND]](/icons/sound2.gif) | Face-Pull UP.mp3 | 2022-08-08 08:23 | 0 | |
![[SND]](/icons/sound2.gif) | warzz.mp3 | 2022-08-08 08:21 | 828K | |
![[SND]](/icons/sound2.gif) | Solomon Islandz Slow MuZyker ft Madrid DJ - [ReGGae Babes] Malapoa Golden Jubilee Live Show RiddiM.mp3 | 2022-08-08 08:20 | 4.7M | |
![[VID]](/icons/movie.gif) | Y2Mate.is - HARDSTYLE 2021 December Mix [ hardstyle mix 132 ]-gvIGrIEkqms-720p-1659906308424.mp4 | 2022-08-08 08:11 | 0 | |
![[SND]](/icons/sound2.gif) | Frontliner - Keep It Up.mp3 | 2022-08-08 08:11 | 0 | |
![[SND]](/icons/sound2.gif) | maafkanaku.mp3 | 2022-08-08 08:06 | 0 | |
![[SND]](/icons/sound2.gif) | comeon.mp3 | 2022-08-08 07:57 | 5.3M | |
![[SND]](/icons/sound2.gif) | Arab.mp3 | 2022-08-08 07:54 | 0 | |
![[SND]](/icons/sound2.gif) | Tom Odell - Another Love (Official Video).mp3 | 2022-08-08 07:52 | 0 | |
![[SND]](/icons/sound2.gif) | Крошка моя, я по тебе скучаю - Руки Вверх (Tik tok) (1).mp3 | 2022-08-08 07:51 | 0 | |
![[SND]](/icons/sound2.gif) | WGAU-AM - Weekday Evening Drive - MF 7p12a - Cox Media Athens.mp3 | 2022-08-08 07:50 | 0 | |
![[SND]](/icons/sound2.gif) | empiremix.mp3 | 2022-08-08 07:48 | 0 | |
![[SND]](/icons/sound2.gif) | DJtiaraSAD.mp3 | 2022-08-08 07:47 | 0 | |
![[SND]](/icons/sound2.gif) | Asem.mp3 | 2022-08-08 07:47 | 393K | |
![[SND]](/icons/sound2.gif) | CLOSE EYES.mp3.mp3 | 2022-08-08 07:43 | 0 | |
![[SND]](/icons/sound2.gif) | DEVIL.mp3 | 2022-08-08 07:42 | 2.4M | |
![[SND]](/icons/sound2.gif) | It_is_realme.mp3 | 2022-08-08 07:41 | 0 | |
![[SND]](/icons/sound2.gif) | galau10.mp3 | 2022-08-08 07:40 | 0 | |
![[SND]](/icons/sound2.gif) | Ronald.mp3 | 2022-08-08 07:39 | 0 | |
![[SND]](/icons/sound2.gif) | UjangKanjut.mp3 | 2022-08-08 07:39 | 3.5M | |
![[SND]](/icons/sound2.gif) | oombal.mp3 | 2022-08-08 07:38 | 0 | |
![[SND]](/icons/sound2.gif) | tothemoon.mp3 | 2022-08-08 07:36 | 0 | |
![[SND]](/icons/sound2.gif) | arawan.mp3 | 2022-08-08 07:36 | 0 | |
![[SND]](/icons/sound2.gif) | abow.mp3 | 2022-08-08 07:36 | 0 | |
![[SND]](/icons/sound2.gif) | Cabi.mp3 | 2022-08-08 07:35 | 0 | |
![[SND]](/icons/sound2.gif) | Kesari2.mp3 | 2022-08-08 07:31 | 0 | |
![[SND]](/icons/sound2.gif) | Paa Sa Lupa - Pilyo Gang Ft. JCF.mp3 | 2022-08-08 07:30 | 0 | |
![[SND]](/icons/sound2.gif) | The Shapes Song.mp3 | 2022-08-08 07:30 | 0 | |
![[SND]](/icons/sound2.gif) | Dalam-Sepiku-Kaulah-Candaku.mp3 | 2022-08-08 07:30 | 0 | |
![[SND]](/icons/sound2.gif) | Dalam-Sepiku-Kaulah-Candaku-Rendy-Andika-ft-Mita-Mpot-Cintaku-DJ-Topeng-Remix_9dzyhPzTIfk (mp3cut.net).mp3 | 2022-08-08 07:28 | 0 | |
![[SND]](/icons/sound2.gif) | pipi.mp3 | 2022-08-08 07:28 | 0 | |
![[SND]](/icons/sound2.gif) | usai.mp3 | 2022-08-08 07:26 | 3.4M | |
![[SND]](/icons/sound2.gif) | Candaku.mp3 | 2022-08-08 07:26 | 0 | |
![[SND]](/icons/sound2.gif) | Dalam-Sepiku-Kaulah-Candaku-Rendy-Andika-ft-Mita-Mpot-Cintaku-DJ-Topeng-Remix_9dzyhPzTIfk (mp3cut.net) (1).mp3 | 2022-08-08 07:25 | 0 | |
![[SND]](/icons/sound2.gif) | Hello.mp3 | 2022-08-08 07:24 | 0 | |
![[SND]](/icons/sound2.gif) | DJ 1.mp3 | 2022-08-08 07:23 | 0 | |
![[SND]](/icons/sound2.gif) | Dalam sepiku kaulah candaku.mp3 | 2022-08-08 07:21 | 0 | |
![[SND]](/icons/sound2.gif) | Cintaku1.mp3 | 2022-08-08 07:19 | 0 | |
![[SND]](/icons/sound2.gif) | Toyang.mp3 | 2022-08-08 07:19 | 0 | |
![[SND]](/icons/sound2.gif) | hal.mp3 | 2022-08-08 07:18 | 2.4M | |
![[SND]](/icons/sound2.gif) | Djnyaman0.mp3 | 2022-08-08 07:18 | 0 | |
![[SND]](/icons/sound2.gif) | Cintaku.mp3 | 2022-08-08 07:18 | 0 | |
![[SND]](/icons/sound2.gif) | runtuh2.mp3 | 2022-08-08 07:17 | 0 | |
![[SND]](/icons/sound2.gif) | bangunselfie.mp3 | 2022-08-08 07:17 | 0 | |
![[SND]](/icons/sound2.gif) | Dia.mp3 | 2022-08-08 07:16 | 0 | |
![[SND]](/icons/sound2.gif) | sikok.mp3 | 2022-08-08 07:15 | 4.6M | |
![[SND]](/icons/sound2.gif) | Casablanca.mp3 | 2022-08-08 07:14 | 436K | |
![[SND]](/icons/sound2.gif) | Eraserheads - Toyang.mp3 | 2022-08-08 07:13 | 0 | |
![[SND]](/icons/sound2.gif) | 2rbina 2rista - Бабадук.mp3 | 2022-08-08 07:13 | 0 | |
![[SND]](/icons/sound2.gif) | kopilam.mp3 | 2022-08-08 07:12 | 0 | |
![[SND]](/icons/sound2.gif) | DK - Я Тут.mp3 | 2022-08-08 07:12 | 52K | |
![[SND]](/icons/sound2.gif) | snap.mp3 | 2022-08-08 07:06 | 0 | |
![[SND]](/icons/sound2.gif) | bow.mp3 | 2022-08-08 07:01 | 0 | |
![[SND]](/icons/sound2.gif) | sunro.mp3 | 2022-08-08 06:56 | 0 | |
![[SND]](/icons/sound2.gif) | mo.mp3 | 2022-08-08 06:56 | 0 | |
![[SND]](/icons/sound2.gif) | nuha_bahrin_naufal_azrin_casablanca_official_music_video_8845422238622974089 (mp3cut.net) (1).mp3 | 2022-08-08 06:53 | 0 | |
![[SND]](/icons/sound2.gif) | Bk6Fh4.mp3 | 2022-08-08 06:49 | 0 | |
![[SND]](/icons/sound2.gif) | dakara.mp3 | 2022-08-08 06:46 | 0 | |
![[SND]](/icons/sound2.gif) | Con.mp3 | 2022-08-08 06:43 | 0 | |
![[SND]](/icons/sound2.gif) | mp3-now.com - One Piece Overtaken 720p HD.mp3 | 2022-08-08 06:43 | 0 | |
![[SND]](/icons/sound2.gif) | TD.mp3 | 2022-08-08 06:40 | 0 | |
![[SND]](/icons/sound2.gif) | 24kGoldn - Mood ft. Iann Dior Why you always in a mood .mp3 | 2022-08-08 06:40 | 0 | |
![[SND]](/icons/sound2.gif) | dangdut1.mp3 | 2022-08-08 06:39 | 1.0M | |
![[SND]](/icons/sound2.gif) | dangdut.mp3 | 2022-08-08 06:38 | 2.5M | |
![[SND]](/icons/sound2.gif) | One Piece - Overtaken 720p HD.mp3 | 2022-08-08 06:37 | 0 | |
![[SND]](/icons/sound2.gif) | RAINBOE.mp3 | 2022-08-08 06:35 | 0 | |
![[SND]](/icons/sound2.gif) | kuz9ka-ya-sipuyu-lin.mp3 | 2022-08-08 06:35 | 180K | |
![[VID]](/icons/movie.gif) | 02257501d1c059a2aad2eeed138746a7.mp4 | 2022-08-08 06:34 | 52K | |
![[SND]](/icons/sound2.gif) | sample-3s.mp3 | 2022-08-08 06:33 | 51K | |
![[SND]](/icons/sound2.gif) | manifest.mp3 | 2022-08-08 06:33 | 3.5M | |
![[SND]](/icons/sound2.gif) | Boy Pablo - Best of Playlist-[onlinevideoconverter.com].mp3 | 2022-08-08 06:31 | 0 | |
![[SND]](/icons/sound2.gif) | videoplayback_2-[onlinevideoconverter.com].mp3 | 2022-08-08 06:31 | 38M | |
![[SND]](/icons/sound2.gif) | FEEL KOPLO HITS Remix 2020.mp3 | 2022-08-08 06:30 | 5.3M | |
![[SND]](/icons/sound2.gif) | coyote theory - this side of paradise [slowed + reverb].mp3 | 2022-08-08 06:30 | 0 | |
![[SND]](/icons/sound2.gif) | DJ LO MATI GUE PARTY COY SAMPE BAWAH SOUND KANE FYP TIKTOK JEDAG JEDUG FULLBASS 2022.mp3 | 2022-08-08 06:30 | 7.0M | |
![[SND]](/icons/sound2.gif) | skinnyfabs - happy (audio).mp3 | 2022-08-08 06:30 | 4.7M | |
![[SND]](/icons/sound2.gif) | LAGU THAILAND OK ARE YOU READY -- TIKTOK VIRAL-[onlinevideoconverter.com].mp3 | 2022-08-08 06:30 | 4.2M | |
![[SND]](/icons/sound2.gif) | DJ MENEKETEHE X STENDING MOTOR X BANGUN TIDUR SELFIE MENGKANE-[onlinevideoconverter.com].mp3 | 2022-08-08 06:30 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ SIKOK BAGI DUO REMIX PALEMBANG JEDAG JEDUG MENGKANE VIRAL TIKTOK.mp3 | 2022-08-08 06:30 | 0 | |
![[SND]](/icons/sound2.gif) | pengen gitu gituan.mp3 | 2022-08-08 06:28 | 0 | |
![[SND]](/icons/sound2.gif) | pestarakyat.mp3 | 2022-08-08 06:28 | 0 | |
![[SND]](/icons/sound2.gif) | nuha_bahrin_naufal_azrin_casablanca_official_music_video_8845422238622974089.mp3 | 2022-08-08 06:25 | 2.9M | |
![[SND]](/icons/sound2.gif) | happy5.mp3 | 2022-08-08 06:23 | 0 | |
![[SND]](/icons/sound2.gif) | METAN - Шнурки (Шнурки).mp3 | 2022-08-08 06:18 | 0 | |
![[SND]](/icons/sound2.gif) | happy1.mp3 | 2022-08-08 06:12 | 0 | |
![[SND]](/icons/sound2.gif) | bumer.mp3 | 2022-08-08 06:11 | 0 | |
![[SND]](/icons/sound2.gif) | pengen.mp3 | 2022-08-08 06:08 | 0 | |
![[SND]](/icons/sound2.gif) | 1580241685_gorky-park-moscow-calling.mp3 | 2022-08-08 06:05 | 0 | |
![[SND]](/icons/sound2.gif) | COLA.mp3 | 2022-08-08 06:04 | 0 | |
![[SND]](/icons/sound2.gif) | thallumala.mp3 | 2022-08-08 06:03 | 0 | |
![[SND]](/icons/sound2.gif) | Sunroof.mp3 | 2022-08-08 06:03 | 0 | |
![[SND]](/icons/sound2.gif) | MARRYME.mp3 | 2022-08-08 06:00 | 3.4M | |
![[SND]](/icons/sound2.gif) | Rill3.mp3 | 2022-08-08 05:59 | 0 | |
![[SND]](/icons/sound2.gif) | cinta.mp3 | 2022-08-08 05:59 | 3.5M | |
![[SND]](/icons/sound2.gif) | Rill2.mp3 | 2022-08-08 05:58 | 0 | |
![[SND]](/icons/sound2.gif) | Rill1.mp3 | 2022-08-08 05:58 | 0 | |
![[SND]](/icons/sound2.gif) | someday.mp3 | 2022-08-08 05:56 | 0 | |
![[SND]](/icons/sound2.gif) | maybe.mp3 | 2022-08-08 05:56 | 0 | |
![[SND]](/icons/sound2.gif) | lagu 1.mp3 | 2022-08-08 05:47 | 0 | |
![[SND]](/icons/sound2.gif) | houseelectrified.mp3 | 2022-08-08 05:47 | 0 | |
![[SND]](/icons/sound2.gif) | MMK10.mp3 | 2022-08-08 05:46 | 0 | |
![[SND]](/icons/sound2.gif) | dubstepd.mp3 | 2022-08-08 05:44 | 0 | |
![[SND]](/icons/sound2.gif) | mp3juice1s.cc - DJ RIP LOVE FAOUZIA REMIX TERBARU FULL BASS DJ Opus (128kbps).mp3 | 2022-08-08 05:43 | 0 | |
![[SND]](/icons/sound2.gif) | audiohub__4066141022963_loveless__testversion.mp3 | 2022-08-08 05:43 | 0 | |
![[SND]](/icons/sound2.gif) | audiohub__4066141007229_true-dreams__testversion.mp3 | 2022-08-08 05:43 | 0 | |
![[SND]](/icons/sound2.gif) | audiohub__4066141014685_inside-me__testversion.mp3 | 2022-08-08 05:43 | 0 | |
![[SND]](/icons/sound2.gif) | audiohub__4066141017754_sip-your-heart-out__testversion.mp3 | 2022-08-08 05:43 | 0 | |
![[SND]](/icons/sound2.gif) | audiohub__4066141016238_all-good-things__testversion.mp3 | 2022-08-08 05:43 | 0 | |
![[SND]](/icons/sound2.gif) | 54.mp3 | 2022-08-08 05:39 | 0 | |
![[SND]](/icons/sound2.gif) | ari1.mp3 | 2022-08-08 05:36 | 0 | |
![[SND]](/icons/sound2.gif) | 7039057277080324866.mp3 | 2022-08-08 05:34 | 0 | |
![[SND]](/icons/sound2.gif) | staplegun-bin-bonkers_456246340.mp3 | 2022-08-08 05:33 | 0 | |
![[SND]](/icons/sound2.gif) | miyagi-andy-panda-patron-mp3.mp3 | 2022-08-08 05:30 | 8.6M | |
![[SND]](/icons/sound2.gif) | CNB4.mp3 | 2022-08-08 05:30 | 0 | |
![[SND]](/icons/sound2.gif) | UJAN.mp3 | 2022-08-08 05:27 | 4.6M | |
![[SND]](/icons/sound2.gif) | TOBAT.mp3 | 2022-08-08 05:27 | 2.5M | |
![[SND]](/icons/sound2.gif) | SED2.mp3 | 2022-08-08 05:27 | 2.5M | |
![[SND]](/icons/sound2.gif) | SED1.mp3 | 2022-08-08 05:26 | 3.2M | |
![[SND]](/icons/sound2.gif) | PDI.mp3 | 2022-08-08 05:26 | 0 | |
![[SND]](/icons/sound2.gif) | uify.mp3 | 2022-08-08 05:26 | 0 | |
![[SND]](/icons/sound2.gif) | NGRP1.mp3 | 2022-08-08 05:26 | 0 | |
![[SND]](/icons/sound2.gif) | ARA.mp3 | 2022-08-08 05:25 | 0 | |
![[SND]](/icons/sound2.gif) | 50 Cent _rmx.mp3 | 2022-08-08 05:25 | 0 | |
![[SND]](/icons/sound2.gif) | MONS - Labass ft flenn ( Official Music Video )(MP3_70K).mp3 | 2022-08-08 05:25 | 2.1M | |
![[SND]](/icons/sound2.gif) | 8.mp3 | 2022-08-08 05:24 | 0 | |
![[SND]](/icons/sound2.gif) | 7.mp3 | 2022-08-08 05:24 | 0 | |
![[SND]](/icons/sound2.gif) | Neulovimyjj_-_A_po_rajjonu_brodit_parnishka_72536174.mp3 | 2022-08-08 05:24 | 0 | |
![[SND]](/icons/sound2.gif) | Beethoven - For Elise (Für Elise), Bagatelle No. 25 in A minor.mp3 | 2022-08-08 05:21 | 0 | |
![[SND]](/icons/sound2.gif) | 7059594761958591259.mp3 | 2022-08-08 05:17 | 0 | |
![[SND]](/icons/sound2.gif) | Девочка Оскар (Dj GLAZUR Remix).mp3 | 2022-08-08 05:16 | 0 | |
![[SND]](/icons/sound2.gif) | tiktok1659935553675.mp3 | 2022-08-08 05:14 | 0 | |
![[SND]](/icons/sound2.gif) | panaloezmill.mp3 | 2022-08-08 05:11 | 0 | |
![[SND]](/icons/sound2.gif) | Genjer1.mp3 | 2022-08-08 05:11 | 0 | |
![[SND]](/icons/sound2.gif) | tiktok1659928111013.mp3 | 2022-08-08 05:10 | 0 | |
![[SND]](/icons/sound2.gif) | 👑Bass prod.by Tolik_Beats👑 - Красный сарафан.mp3 | 2022-08-08 05:08 | 0 | |
![[SND]](/icons/sound2.gif) | 𝙱𝙴𝚂𝙸𝙺.𝟻𝟶𝟶🤺 - связался с пиратами. (www.hotplayer.ru).mp3 | 2022-08-08 05:08 | 0 | |
![[SND]](/icons/sound2.gif) | meomeowie4.mp3 | 2022-08-08 05:02 | 0 | |
![[SND]](/icons/sound2.gif) | cheb Rami ana nbgi.dj rafik.mp3 | 2022-08-08 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | Manik.mp3 | 2022-08-08 04:58 | 0 | |
![[SND]](/icons/sound2.gif) | MONEYKEN LOVE.mp3 | 2022-08-08 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | Banding.mp3 | 2022-08-08 04:32 | 0 | |
![[VID]](/icons/movie.gif) | lv_7128815052555177217_20220807172223.mp4 | 2022-08-08 04:31 | 0 | |
![[SND]](/icons/sound2.gif) | Ingay.mp3 | 2022-08-08 04:28 | 0 | |
![[SND]](/icons/sound2.gif) | walkie-talkie-turn-on-beep-SBA-300149699-preview.mp3 | 2022-08-08 04:26 | 0 | |
![[SND]](/icons/sound2.gif) | DJ-CAMPURAN-FYP-TIKTOK-VIRAL-TERBARU-JEDAG-JEDUG-FULL-BASS-MENGKANE-2022_uIqdNZJmfpM.mp3 | 2022-08-08 04:22 | 0 | |
![[SND]](/icons/sound2.gif) | CLOSE-YOUR-EYE-X-BANGUN-TIDUR-SELFI-X-GO-SAMPE-BAWAH-Slowed-Version_6ab21EuYXRM.mp3 | 2022-08-08 04:17 | 0 | |
![[SND]](/icons/sound2.gif) | djsans.mp3 | 2022-08-08 04:13 | 0 | |
![[SND]](/icons/sound2.gif) | blexed.mp3 | 2022-08-08 04:10 | 960K | |
![[SND]](/icons/sound2.gif) | Zpartan9.mp3 | 2022-08-08 04:06 | 1.9M | |
![[VID]](/icons/movie.gif) | 5fa0fd6f-f5ee-6aca-e44d-1cf6cb661808_custom.mp4 | 2022-08-08 04:04 | 0 | |
![[SND]](/icons/sound2.gif) | Deathnote.mp3 | 2022-08-08 04:04 | 0 | |
![[SND]](/icons/sound2.gif) | Hamdeh.mp3 | 2022-08-08 04:00 | 0 | |
![[SND]](/icons/sound2.gif) | Survival1.mp3 | 2022-08-08 03:59 | 0 | |
![[SND]](/icons/sound2.gif) | Arcade3.mp3 | 2022-08-08 03:58 | 0 | |
![[SND]](/icons/sound2.gif) | felicitacionCorregida.mp3 | 2022-08-08 03:57 | 0 | |
![[SND]](/icons/sound2.gif) | Arcade2.mp3 | 2022-08-08 03:55 | 2.6M | |
![[SND]](/icons/sound2.gif) | MidgeUreTheManWhoSoldtheWorld.mp3 | 2022-08-08 03:52 | 0 | |
![[SND]](/icons/sound2.gif) | Hot Freaks-Puppy-Princess.mp3 | 2022-08-08 03:52 | 0 | |
![[SND]](/icons/sound2.gif) | CrystalCastles-Vanished.mp3 | 2022-08-08 03:51 | 0 | |
![[SND]](/icons/sound2.gif) | Geneburn-Countdown.mp3 | 2022-08-08 03:51 | 0 | |
![[SND]](/icons/sound2.gif) | Sova-pervii-sneg.mp3 | 2022-08-08 03:51 | 0 | |
![[SND]](/icons/sound2.gif) | Yanka-Na-cherni-den.mp3 | 2022-08-08 03:51 | 0 | |
![[SND]](/icons/sound2.gif) | Sos-Sam-po-sebe.mp3 | 2022-08-08 03:51 | 0 | |
![[SND]](/icons/sound2.gif) | Nauchnii-Sotrudnik-Gadkaya-bogema.mp3 | 2022-08-08 03:51 | 0 | |
![[SND]](/icons/sound2.gif) | Titanium-Mittsies.mp3 | 2022-08-08 03:51 | 0 | |
![[SND]](/icons/sound2.gif) | Lil-Darkie-rapmusic.mp3 | 2022-08-08 03:51 | 1.8M | |
![[SND]](/icons/sound2.gif) | Arcade1.mp3 | 2022-08-08 03:49 | 2.4M | |
![[SND]](/icons/sound2.gif) | oteyz.mp3 | 2022-08-08 03:46 | 0 | |
![[SND]](/icons/sound2.gif) | devilindehos.mp3 | 2022-08-08 03:45 | 0 | |
![[SND]](/icons/sound2.gif) | Omar_Rising_Aisha_Saeed_z-lib.org.mp3 | 2022-08-08 03:42 | 0 | |
![[SND]](/icons/sound2.gif) | kasal.mp3 | 2022-08-08 03:36 | 3.4M | |
![[SND]](/icons/sound2.gif) | Sunflower.mp3 | 2022-08-08 03:21 | 3.6M | |
![[SND]](/icons/sound2.gif) | 21guns.mp3 | 2022-08-08 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | thuyenquyen.mp3 | 2022-08-08 03:11 | 0 | |
![[SND]](/icons/sound2.gif) | Moresex.m4a | 2022-08-08 03:09 | 0 | |
![[SND]](/icons/sound2.gif) | Circles.mp3 | 2022-08-08 03:08 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - TRICKSTER ANTHEM Official Music Video.mp3 | 2022-08-08 03:07 | 0 | |
![[SND]](/icons/sound2.gif) | MohamedZhani.mp3 | 2022-08-08 03:06 | 0 | |
![[SND]](/icons/sound2.gif) | VINH.mp3 | 2022-08-08 03:03 | 0 | |
![[SND]](/icons/sound2.gif) | VinhVINAMILK.mp3 | 2022-08-08 03:01 | 0 | |
![[SND]](/icons/sound2.gif) | 3mo Zhani.mp3 | 2022-08-08 02:55 | 0 | |
![[SND]](/icons/sound2.gif) | MOHAMED_ZHANI.m4a | 2022-08-08 02:52 | 0 | |
![[SND]](/icons/sound2.gif) | Inkonnu - CHILL ( OFFICIAL LYRIC VIDEO) Prod by _ RESSAY(M4A_128K).m4a | 2022-08-08 02:50 | 0 | |
![[SND]](/icons/sound2.gif) | Kara Deri - Вернёшься (ThreeV Remix)(1).mp3 | 2022-08-08 02:44 | 0 | |
![[SND]](/icons/sound2.gif) | 20220808_102434.m4a | 2022-08-08 02:36 | 0 | |
![[SND]](/icons/sound2.gif) | Died.mp3 | 2022-08-08 02:26 | 0 | |
![[SND]](/icons/sound2.gif) | CrystalCastlesVanished.mp3 | 2022-08-08 02:25 | 0 | |
![[SND]](/icons/sound2.gif) | Science.mp3 | 2022-08-08 02:25 | 0 | |
![[SND]](/icons/sound2.gif) | TitaniumMittsies.mp3 | 2022-08-08 02:25 | 0 | |
![[SND]](/icons/sound2.gif) | MidgeUreThe ManWhoSoldtheWorld.mp3 | 2022-08-08 02:25 | 0 | |
![[SND]](/icons/sound2.gif) | Owl.mp3 | 2022-08-08 02:25 | 0 | |
![[SND]](/icons/sound2.gif) | HotFreaksPuppyPrincess.mp3 | 2022-08-08 02:25 | 0 | |
![[SND]](/icons/sound2.gif) | semalam.mp3 | 2022-08-08 02:24 | 952K | |
![[SND]](/icons/sound2.gif) | AUD-20220716-WA0003.mp3 | 2022-08-08 02:22 | 0 | |
![[SND]](/icons/sound2.gif) | Lil Darkierapmusic.mp3 | 2022-08-08 02:21 | 0 | |
![[SND]](/icons/sound2.gif) | Yanka(Remastered).mp3 | 2022-08-08 02:21 | 0 | |
![[SND]](/icons/sound2.gif) | Science .mp3 | 2022-08-08 02:21 | 0 | |
![[SND]](/icons/sound2.gif) | Midge UreThe ManWhoSoldtheWorld.mp3 | 2022-08-08 02:21 | 0 | |
![[SND]](/icons/sound2.gif) | Geneburn (2).mp3 | 2022-08-08 02:21 | 0 | |
![[SND]](/icons/sound2.gif) | Hot FreaksPuppyPrincess.mp3 | 2022-08-08 02:21 | 0 | |
![[SND]](/icons/sound2.gif) | y2meta.com - Ta Say - APJ x Helia x Masew (128 kbps).mp3 | 2022-08-08 02:13 | 0 | |
![[SND]](/icons/sound2.gif) | ahmadshamal44.mp3 | 2022-08-08 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | niko21.mp3 | 2022-08-08 02:03 | 0 | |
![[SND]](/icons/sound2.gif) | Habangb.mp3 | 2022-08-08 02:02 | 0 | |
![[SND]](/icons/sound2.gif) | inbound4367460822511391083.mp3 | 2022-08-08 02:01 | 0 | |
![[SND]](/icons/sound2.gif) | Dangdutan.mp3 | 2022-08-08 01:47 | 0 | |
![[SND]](/icons/sound2.gif) | ahmadshamal21.mp3 | 2022-08-08 01:44 | 0 | |
![[SND]](/icons/sound2.gif) | nevermind.mp3 | 2022-08-08 01:44 | 0 | |
![[SND]](/icons/sound2.gif) | sadr2444.mp3 | 2022-08-08 01:43 | 0 | |
![[SND]](/icons/sound2.gif) | Sting weed love song _Audio_766611_Bass Booster(1).mp3 | 2022-08-08 01:39 | 0 | |
![[SND]](/icons/sound2.gif) | music_test2_منوعات الديدجي_اغاني-جزائرية_Cheb Faudil - Kont Na3tiha Masrouf.mp3 | 2022-08-08 01:33 | 0 | |
![[SND]](/icons/sound2.gif) | elsanokomen.mp3 | 2022-08-08 01:31 | 0 | |
![[SND]](/icons/sound2.gif) | galau9.mp3 | 2022-08-08 01:30 | 0 | |
![[SND]](/icons/sound2.gif) | NIRVANA3.mp3 | 2022-08-08 01:29 | 4.4M | |
![[SND]](/icons/sound2.gif) | NIRVANA2.MP.mp3 | 2022-08-08 01:26 | 8.7M | |
![[SND]](/icons/sound2.gif) | Urogeh4.mp3 | 2022-08-08 01:22 | 5.8M | |
![[SND]](/icons/sound2.gif) | NIRVANA1.mp3 | 2022-08-08 01:21 | 4.6M | |
![[SND]](/icons/sound2.gif) | setfire.mp3 | 2022-08-08 01:17 | 3.4M | |
![[SND]](/icons/sound2.gif) | tune.mp3 | 2022-08-08 01:17 | 2.6M | |
![[SND]](/icons/sound2.gif) | buadi.mp3 | 2022-08-08 01:13 | 4.2M | |
![[SND]](/icons/sound2.gif) | rotchovoibotsaulo.mp3 | 2022-08-08 01:13 | 2.9M | |
![[SND]](/icons/sound2.gif) | cua.mp3 | 2022-08-08 01:13 | 3.0M | |
![[SND]](/icons/sound2.gif) | lucnho.mp3 | 2022-08-08 01:13 | 2.4M | |
![[SND]](/icons/sound2.gif) | cotienxanh.mp3 | 2022-08-08 01:13 | 6.8M | |
![[SND]](/icons/sound2.gif) | choi.mp3 | 2022-08-08 01:13 | 3.9M | |
![[SND]](/icons/sound2.gif) | maskoff.mp3 | 2022-08-08 01:13 | 4.5M | |
![[SND]](/icons/sound2.gif) | give.mp3 | 2022-08-08 01:13 | 3.6M | |
![[SND]](/icons/sound2.gif) | rolling.mp3 | 2022-08-08 01:13 | 2.9M | |
![[SND]](/icons/sound2.gif) | muonchoitao.mp3 | 2022-08-08 01:13 | 4.9M | |
![[SND]](/icons/sound2.gif) | 121.mp3 | 2022-08-08 01:13 | 1.9M | |
![[SND]](/icons/sound2.gif) | thanhxuan.mp3 | 2022-08-08 01:13 | 3.4M | |
![[SND]](/icons/sound2.gif) | dat.mp3 | 2022-08-08 01:13 | 2.0M | |
![[SND]](/icons/sound2.gif) | ikigai.mp3 | 2022-08-08 01:13 | 3.7M | |
![[SND]](/icons/sound2.gif) | industrybaby.mp3 | 2022-08-08 01:13 | 3.2M | |
![[SND]](/icons/sound2.gif) | nhumotnhangia.mp3 | 2022-08-08 01:13 | 4.8M | |
![[SND]](/icons/sound2.gif) | drill.mp3 | 2022-08-08 01:13 | 2.4M | |
![[SND]](/icons/sound2.gif) | what.mp3 | 2022-08-08 01:13 | 2.1M | |
![[SND]](/icons/sound2.gif) | thuyenvang.mp3 | 2022-08-08 01:13 | 4.2M | |
![[SND]](/icons/sound2.gif) | homieweed.mp3 | 2022-08-08 01:13 | 6.2M | |
![[SND]](/icons/sound2.gif) | nhungmonde.mp3 | 2022-08-08 01:13 | 3.2M | |
![[SND]](/icons/sound2.gif) | lamthem.mp3 | 2022-08-08 01:13 | 3.1M | |
![[SND]](/icons/sound2.gif) | tien.mp3 | 2022-08-08 01:13 | 3.1M | |
![[SND]](/icons/sound2.gif) | godfaher.mp3 | 2022-08-08 01:13 | 2.6M | |
![[SND]](/icons/sound2.gif) | galau8.mp3 | 2022-08-08 01:12 | 2.4M | |
![[SND]](/icons/sound2.gif) | galau7.mp3 | 2022-08-08 01:03 | 4.3M | |
![[SND]](/icons/sound2.gif) | Poker Face - Lady Gaga (Lyrics).mp3 | 2022-08-08 01:03 | 0 | |
![[SND]](/icons/sound2.gif) | fahrezy2.mp3 | 2022-08-08 01:02 | 280K | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - Bitches - MSI ★ [SPED UPNIGHTCORE]-zwfhtdUllmY-160k-1659850548255.mp3 | 2022-08-08 00:49 | 0 | |
![[SND]](/icons/sound2.gif) | REYNE.mp3 | 2022-08-08 00:46 | 0 | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - nico's nextbots music stepback - nicopatty feat deet sped up + high pitch-ePP0lhYgaSY-128k-1659262886931.mp3 | 2022-08-08 00:45 | 0 | |
![[SND]](/icons/sound2.gif) | fahrezy1.mp3 | 2022-08-08 00:31 | 4.9M | |
![[SND]](/icons/sound2.gif) | Rob.mp3 | 2022-08-08 00:31 | 519K | |
![[SND]](/icons/sound2.gif) | tiMO21.mp3 | 2022-08-08 00:28 | 2.5M | |
![[SND]](/icons/sound2.gif) | galau6.mp3 | 2022-08-08 00:22 | 4.4M | |
![[SND]](/icons/sound2.gif) | galau5.mp3 | 2022-08-08 00:19 | 3.4M | |
![[SND]](/icons/sound2.gif) | WRAITH2.mp3 | 2022-08-08 00:19 | 1.2M | |
![[SND]](/icons/sound2.gif) | O que é mulher.mp3 | 2022-08-08 00:18 | 287K | |
![[SND]](/icons/sound2.gif) | galau3.mp3 | 2022-08-08 00:16 | 3.5M | |
![[SND]](/icons/sound2.gif) | galau2.mp3 | 2022-08-08 00:12 | 3.0M | |
![[SND]](/icons/sound2.gif) | galau1.mp3 | 2022-08-08 00:07 | 3.4M | |
![[SND]](/icons/sound2.gif) | Ralph - Tables Have Turned (Lyrics).mp3 | 2022-08-08 00:07 | 0 | |
![[SND]](/icons/sound2.gif) | y2meta (mp3cut.net).mp3 | 2022-08-08 00:02 | 0 | |
![[SND]](/icons/sound2.gif) | Dhije290.mp3 | 2022-08-07 23:58 | 0 | |
![[SND]](/icons/sound2.gif) | Galau.mp3 | 2022-08-07 23:57 | 3.8M | |
![[SND]](/icons/sound2.gif) | ncomment.mp3 | 2022-08-07 23:56 | 2.8M | |
![[SND]](/icons/sound2.gif) | SAD8.mp3 | 2022-08-07 23:44 | 0 | |
![[SND]](/icons/sound2.gif) | dhije29.mp3 | 2022-08-07 23:39 | 0 | |
![[SND]](/icons/sound2.gif) | byeji.mp3 | 2022-08-07 23:26 | 0 | |
![[SND]](/icons/sound2.gif) | kgnikmakino.mp3 | 2022-08-07 23:21 | 0 | |
![[SND]](/icons/sound2.gif) | Миронов🥀 - бандит [slow + remix].mp3 | 2022-08-07 23:17 | 0 | |
![[SND]](/icons/sound2.gif) | IV_OF_SPADES_-_Where_Have_You_Been,_My_Disco?_(Official_Video)(256k).mp3 | 2022-08-07 23:12 | 0 | |
![[SND]](/icons/sound2.gif) | onlymp3.to - Epic Celtic Battle Music - Battle For Camelot (Tartalo Music)-NBpu3Fhvkdc-192k-1659913791956.mp3 | 2022-08-07 23:11 | 0 | |
![[SND]](/icons/sound2.gif) | dora_-_Dora_dura_67181158.mp3 | 2022-08-07 23:00 | 0 | |
![[SND]](/icons/sound2.gif) | yoksun.mp3 | 2022-08-07 22:58 | 0 | |
![[SND]](/icons/sound2.gif) | avicii.mp3 | 2022-08-07 22:56 | 0 | |
![[SND]](/icons/sound2.gif) | aviciitriangle.mp3 | 2022-08-07 22:53 | 0 | |
![[SND]](/icons/sound2.gif) | STORMY - AFRICAIN (Prod. VBGotHeat) (Lyrics Video).mp3 | 2022-08-07 22:52 | 0 | |
![[SND]](/icons/sound2.gif) | cheb Rami ana nbgi.. zin💥🖤 dj rafik.mp3 | 2022-08-07 22:50 | 0 | |
![[SND]](/icons/sound2.gif) | Through_The_Flames🎵Most Epic Music Inspiring🎼Epic Music Adventure.mp3 | 2022-08-07 22:47 | 0 | |
![[SND]](/icons/sound2.gif) | انا مريول..ونبغي..زينcheb Rami ana nbgi.. zin💥🖤 dj rafik.mp3 | 2022-08-07 22:46 | 240K | |
![[SND]](/icons/sound2.gif) | alasa.mp3 | 2022-08-07 22:39 | 0 | |
![[SND]](/icons/sound2.gif) | WEADING.mp3 | 2022-08-07 22:34 | 0 | |
![[SND]](/icons/sound2.gif) | Indila_-_Tourner_Dans_Le_Vide_48105407 (1).mp3 | 2022-08-07 22:24 | 0 | |
![[SND]](/icons/sound2.gif) | Люблю Мариночку.mp3 | 2022-08-07 22:21 | 0 | |
![[SND]](/icons/sound2.gif) | Nenad1.mp3 | 2022-08-07 22:17 | 0 | |
![[SND]](/icons/sound2.gif) | xd.mp3 | 2022-08-07 22:13 | 0 | |
![[SND]](/icons/sound2.gif) | THRILL_PILL_-_YA_ne_rebjonok_53420169.mp3 | 2022-08-07 22:12 | 0 | |
![[SND]](/icons/sound2.gif) | Казённый унитаз — Моча съела говно (www.lightaudio.ru).mp3 | 2022-08-07 22:11 | 0 | |
![[SND]](/icons/sound2.gif) | xo.mp3 | 2022-08-07 22:05 | 0 | |
![[SND]](/icons/sound2.gif) | y2meta.com - KXNVRA - BLOWIN' (128 kbps).mp3 | 2022-08-07 22:04 | 0 | |
![[SND]](/icons/sound2.gif) | -Full HD- Hoshizora Monogatari - Nana Takahashi(MP3_320K).mp3 | 2022-08-07 21:55 | 0 | |
![[SND]](/icons/sound2.gif) | nast0715.mp3 | 2022-08-07 21:53 | 0 | |
![[SND]](/icons/sound2.gif) | hdn0715.mp3 | 2022-08-07 21:50 | 0 | |
![[SND]](/icons/sound2.gif) | xj.mp3 | 2022-08-07 21:46 | 0 | |
![[SND]](/icons/sound2.gif) | mixkit-game-show-suspense-waiting-667.mp3 | 2022-08-07 21:40 | 0 | |
![[SND]](/icons/sound2.gif) | Ебанько - Денег нету.mp3 | 2022-08-07 21:35 | 0 | |
![[SND]](/icons/sound2.gif) | VTORNIK - Макака.mp3 | 2022-08-07 21:33 | 0 | |
![[SND]](/icons/sound2.gif) | Tu sicaria - Ms Nina letra (NUEVOEXITO.ORG).mp3 | 2022-08-07 21:28 | 0 | |
![[SND]](/icons/sound2.gif) | Arabesque -friday night hit disco 1978.mp3 | 2022-08-07 21:27 | 0 | |
![[SND]](/icons/sound2.gif) | Ratt - Round And Round - HQ Audio (NUEVOEXITO.ORG).mp3 | 2022-08-07 21:26 | 0 | |
![[SND]](/icons/sound2.gif) | teman.mp3 | 2022-08-07 21:22 | 2.9M | |
![[SND]](/icons/sound2.gif) | Simple Plan - Iconic.mp3 | 2022-08-07 21:22 | 0 | |
![[SND]](/icons/sound2.gif) | phonkz.mp3 | 2022-08-07 21:18 | 0 | |
![[SND]](/icons/sound2.gif) | Sad39.mp3 | 2022-08-07 21:15 | 0 | |
![[SND]](/icons/sound2.gif) | Dreaming Up! The Master Mix-[AudioTrimmer.com].mp3 | 2022-08-07 21:04 | 0 | |
![[SND]](/icons/sound2.gif) | Sad7.mp3 | 2022-08-07 21:04 | 0 | |
![[SND]](/icons/sound2.gif) | GOOD.mp3 | 2022-08-07 21:02 | 3.7M | |
![[SND]](/icons/sound2.gif) | SGT.MP.mp3 | 2022-08-07 21:02 | 0 | |
![[SND]](/icons/sound2.gif) | LUCY.mp3 | 2022-08-07 21:02 | 0 | |
![[SND]](/icons/sound2.gif) | Berdua.mp3 | 2022-08-07 21:01 | 0 | |
![[SND]](/icons/sound2.gif) | mala.mp3 | 2022-08-07 20:58 | 0 | |
![[SND]](/icons/sound2.gif) | he-he-he-haw (1).mp3 | 2022-08-07 20:52 | 0 | |
![[SND]](/icons/sound2.gif) | 3.Lucy In The Sky With Diamonds (Remastered 2009).mp3 | 2022-08-07 20:49 | 2.7M | |
![[SND]](/icons/sound2.gif) | 1. Sgt. Pepper's Lonely Hearts Club Band (Remastered 2009).mp3 | 2022-08-07 20:48 | 0 | |
![[SND]](/icons/sound2.gif) | Fear of the Dark (2015 - Remaster).mp3 | 2022-08-07 20:44 | 0 | |
![[SND]](/icons/sound2.gif) | Fear of the Dark (2015 Remaster) (1).mp3 | 2022-08-07 20:42 | 0 | |
![[SND]](/icons/sound2.gif) | LSD X .mp3 | 2022-08-07 20:27 | 0 | |
![[SND]](/icons/sound2.gif) | Я люблю газ давать.mp3 | 2022-08-07 20:16 | 0 | |
![[SND]](/icons/sound2.gif) | brown.mp3 | 2022-08-07 20:15 | 1.8M | |
![[SND]](/icons/sound2.gif) | BIFFGUYZ - Чики.mp3 | 2022-08-07 20:13 | 0 | |
![[SND]](/icons/sound2.gif) | kk.mp3 | 2022-08-07 20:04 | 3.7M | |
![[SND]](/icons/sound2.gif) | ff.mp3 | 2022-08-07 20:02 | 2.0M | |
![[SND]](/icons/sound2.gif) | joyy1.mp3 | 2022-08-07 20:01 | 0 | |
![[SND]](/icons/sound2.gif) | (AOB) (23-26Hz) Waka Flocka Flame feat. Popa Smurf, Slim Dunkin, YG Hootie - Karma (screwed and lb by 400kg) (1).mp3 | 2022-08-07 19:55 | 0 | |
![[SND]](/icons/sound2.gif) | Fear of the Dark (2015 Remaster).mp3 | 2022-08-07 19:50 | 0 | |
![[SND]](/icons/sound2.gif) | videoplayback (1) (online-video-cutter.com) (1).mp3 | 2022-08-07 19:46 | 0 | |
![[SND]](/icons/sound2.gif) | lofisong.mp3 | 2022-08-07 19:45 | 4.0M | |
![[SND]](/icons/sound2.gif) | putanginamo.mp3 | 2022-08-07 19:44 | 1.3M | |
![[SND]](/icons/sound2.gif) | starset_my_demons.mp3 | 2022-08-07 19:40 | 0 | |
![[SND]](/icons/sound2.gif) | Joykontol1.mp3 | 2022-08-07 19:36 | 0 | |
![[SND]](/icons/sound2.gif) | djkontolomeledak1.mp3 | 2022-08-07 19:34 | 0 | |
![[SND]](/icons/sound2.gif) | ADT1.mp3 | 2022-08-07 19:33 | 0 | |
![[SND]](/icons/sound2.gif) | Sad10.mp3 | 2022-08-07 19:32 | 204K | |
![[SND]](/icons/sound2.gif) | Aircheck 1-23 Purdum.mp3 | 2022-08-07 19:30 | 0 | |
![[SND]](/icons/sound2.gif) | genjer.mp3 | 2022-08-07 19:26 | 4.1M | |
![[SND]](/icons/sound2.gif) | Green Day - The Simpsons Theme.mp3 | 2022-08-07 19:21 | 0 | |
![[SND]](/icons/sound2.gif) | radif.mp3 | 2022-08-07 19:20 | 28K | |
![[SND]](/icons/sound2.gif) | breaking_benjamin_angels_fall_official_video_-5030218190492747930.mp3 | 2022-08-07 19:20 | 3.7M | |
![[SND]](/icons/sound2.gif) | arabtik.mp3 | 2022-08-07 19:16 | 0 | |
![[SND]](/icons/sound2.gif) | Баста - Моя игра (feat. Guf).mp3 | 2022-08-07 19:16 | 0 | |
![[SND]](/icons/sound2.gif) | sayaa.mp3 | 2022-08-07 19:15 | 0 | |
![[SND]](/icons/sound2.gif) | Breaking Benjamin - Angels Fall (Official Video).mp3 | 2022-08-07 19:13 | 0 | |
![[SND]](/icons/sound2.gif) | album4.mp3 | 2022-08-07 19:13 | 0 | |
![[SND]](/icons/sound2.gif) | smoraxan.mp3 | 2022-08-07 19:11 | 2.1M | |
![[SND]](/icons/sound2.gif) | Jun.mp3 | 2022-08-07 19:07 | 0 | |
![[SND]](/icons/sound2.gif) | Zaalima .mp3 | 2022-08-07 19:03 | 0 | |
![[SND]](/icons/sound2.gif) | Sak3.mp3 | 2022-08-07 18:59 | 0 | |
![[SND]](/icons/sound2.gif) | Milica Pavlovic Feat. Albino - Seceru (RichMee Remix).mp3 | 2022-08-07 18:59 | 0 | |
![[SND]](/icons/sound2.gif) | Saiyaara [Slowed+Reverb] - Mohit Chauhan _ Musiclovers _ Textaudio.mp3 | 2022-08-07 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | elTRTR.mp3 | 2022-08-07 18:52 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ SIKOK BAGI DUO BASS BETON X SADARKAH KASIH SCS ENTERTAINMENT VIRAL FYP TIKTOK 2022.mp3 | 2022-08-07 18:48 | 0 | |
![[SND]](/icons/sound2.gif) | Виталя[Джа]_(Витя_матанга)_-_Чё-то_типа_жизнь_проходит_мимо_(mp3shnik.ru).mp3 | 2022-08-07 18:40 | 0 | |
![[SND]](/icons/sound2.gif) | Topeng.mp3 | 2022-08-07 18:39 | 0 | |
![[SND]](/icons/sound2.gif) | Juan16.mp3 | 2022-08-07 18:38 | 0 | |
![[SND]](/icons/sound2.gif) | Breskvica - Losa (BackBoy & DJ Boky Mashup) #balkania.mp3 | 2022-08-07 18:37 | 0 | |
![[SND]](/icons/sound2.gif) | colocando_e_travando_cinto_de_seguran_a_seatbelt_sfx_-4786453905378444572.mp3 | 2022-08-07 18:33 | 0 | |
![[SND]](/icons/sound2.gif) | NGANGEN (SAWAL JAWA).mp3 | 2022-08-07 18:30 | 0 | |
![[SND]](/icons/sound2.gif) | AKHIRE LUNGO (IKY JAWA).mp3 | 2022-08-07 18:30 | 0 | |
![[SND]](/icons/sound2.gif) | Old banh.m4a | 2022-08-07 18:30 | 0 | |
![[SND]](/icons/sound2.gif) | LAYANG DUNGO RESTU (IKY JAWA).mp3 | 2022-08-07 18:30 | 0 | |
![[SND]](/icons/sound2.gif) | Lag .mp3 | 2022-08-07 18:28 | 0 | |
![[SND]](/icons/sound2.gif) | reda.mp3 | 2022-08-07 18:21 | 0 | |
![[SND]](/icons/sound2.gif) | Armada4.mp3 | 2022-08-07 18:17 | 0 | |
![[SND]](/icons/sound2.gif) | Armada3.mp3 | 2022-08-07 18:17 | 0 | |
![[SND]](/icons/sound2.gif) | Armada5.mp3 | 2022-08-07 18:17 | 0 | |
![[SND]](/icons/sound2.gif) | azizzorgani.mp3 | 2022-08-07 18:16 | 0 | |
![[SND]](/icons/sound2.gif) | Armada2.mp3 | 2022-08-07 18:16 | 0 | |
![[SND]](/icons/sound2.gif) | kiyo2.mp3 | 2022-08-07 18:04 | 0 | |
![[SND]](/icons/sound2.gif) | ahah1.mp3 | 2022-08-07 18:00 | 0 | |
![[SND]](/icons/sound2.gif) | Ace Banzuelo Muli Official Lyric Video.mp3 | 2022-08-07 17:56 | 0 | |
![[VID]](/icons/movie.gif) | Jed Pineda.mp4 | 2022-08-07 17:52 | 0 | |
![[SND]](/icons/sound2.gif) | ishan3.mp3 | 2022-08-07 17:49 | 0 | |
![[SND]](/icons/sound2.gif) | a.mp3 | 2022-08-07 17:48 | 428K | |
![[SND]](/icons/sound2.gif) | GAYAZOV_BROTHER_-_MALINOVAYA_LADA_73214200.mp3 | 2022-08-07 17:46 | 0 | |
![[SND]](/icons/sound2.gif) | kakaobelogocveta.mp3 | 2022-08-07 17:46 | 0 | |
![[SND]](/icons/sound2.gif) | Cover.mp3 | 2022-08-07 17:42 | 0 | |
![[SND]](/icons/sound2.gif) | 2523-09864-12489.mp3 | 2022-08-07 17:42 | 0 | |
![[SND]](/icons/sound2.gif) | Foufa Torino X Didine Canon 16 X Kader Japonais - Lwalida (Official Music Video)(MP3_320K).mp3 | 2022-08-07 17:41 | 0 | |
![[SND]](/icons/sound2.gif) | 2523-09864-12489-69402-459630.mp3 | 2022-08-07 17:41 | 0 | |
![[SND]](/icons/sound2.gif) | Elisa_Lost_into_the_Night_(Initial_D_1st_Stage _D_Selection 2_)_(www.lightaudio.ru).mp3 | 2022-08-07 17:40 | 0 | |
![[SND]](/icons/sound2.gif) | Jsg.mp3 | 2022-08-07 17:40 | 0 | |
![[SND]](/icons/sound2.gif) | dvoreckov-vpika_(mp3IQ.net).mp3 | 2022-08-07 17:40 | 0 | |
![[SND]](/icons/sound2.gif) | 20181226_200624.mp3 | 2022-08-07 17:39 | 0 | |
![[SND]](/icons/sound2.gif) | Kakao_belogo_cveta-soft nightcore-nightcore_bassboost.mp3 | 2022-08-07 17:38 | 0 | |
![[SND]](/icons/sound2.gif) | kakaobelogo.mp3 | 2022-08-07 17:37 | 1.1M | |
![[SND]](/icons/sound2.gif) | yo-voy_(mp3IQ.net)(mailbox).mp3 | 2022-08-07 17:36 | 0 | |
![[SND]](/icons/sound2.gif) | yo-voy.mp3 | 2022-08-07 17:35 | 0 | |
![[SND]](/icons/sound2.gif) | dvoreckov-vpiska_(mp3IQ.net).mp3 | 2022-08-07 17:33 | 1.6M | |
![[SND]](/icons/sound2.gif) | Vip6.mp3 | 2022-08-07 17:32 | 3.6M | |
![[SND]](/icons/sound2.gif) | kakao-belogo-cveta.mp3 | 2022-08-07 17:32 | 0 | |
![[SND]](/icons/sound2.gif) | 214kakao.mp3 | 2022-08-07 17:31 | 0 | |
![[SND]](/icons/sound2.gif) | JALA BRAT X BUBA CORRELI - PILULA.mp3 | 2022-08-07 17:27 | 0 | |
![[SND]](/icons/sound2.gif) | Pyrokinesis_-_YA_pridu_k_tebe_s_klubnikojj_v_dekabre_55936377.mp3 | 2022-08-07 17:27 | 0 | |
![[SND]](/icons/sound2.gif) | 1kgkakao.mp3 | 2022-08-07 17:26 | 468K | |
![[SND]](/icons/sound2.gif) | JALA BRAT X BUBA CORRELI - PILULA (SOUNDADDICTS MASHUP)#Balkania.mp3 | 2022-08-07 17:25 | 3.3M | |
![[SND]](/icons/sound2.gif) | X2Download.com - ꧁☆(☢‿☢)☆꧂ - Какао белого цвета (Nightcore) (192 kbps).mp3 | 2022-08-07 17:23 | 0 | |
![[SND]](/icons/sound2.gif) | Nagumo.mp3 | 2022-08-07 17:22 | 0 | |
![[SND]](/icons/sound2.gif) | какао белого цвета.mp3 | 2022-08-07 17:21 | 4.3M | |
![[SND]](/icons/sound2.gif) | Неизвестен - Без названия.mp3 | 2022-08-07 17:20 | 4.3M | |
![[SND]](/icons/sound2.gif) | sholawat.mp3 | 2022-08-07 17:20 | 2.0M | |
![[SND]](/icons/sound2.gif) | Isa - Andro (Lyrics) _ andro _ _ sonnaya lunnaya .mp3 | 2022-08-07 17:19 | 0 | |
![[SND]](/icons/sound2.gif) | Vitamin_String_Quartet_J_Hisaishi_-_Howls_Moving_Castle_-_Merry_Go_Round_of_Life_51057163.mp3 | 2022-08-07 17:19 | 0 | |
![[SND]](/icons/sound2.gif) | Lizer_-_Pachka_sigaret_57408715.mp3 | 2022-08-07 17:19 | 6.5M | |
![[SND]](/icons/sound2.gif) | Poyi1.mp3 | 2022-08-07 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | risk.mp3 | 2022-08-07 17:15 | 2.6M | |
![[SND]](/icons/sound2.gif) | Vip5.mp3 | 2022-08-07 17:15 | 2.3M | |
![[SND]](/icons/sound2.gif) | Be Notorious (Title Track).mp3 | 2022-08-07 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | this-is-war-loopable-95413.mp3 | 2022-08-07 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | Sad23.mp3 | 2022-08-07 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | juned1.mp3 | 2022-08-07 17:08 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ CAMPURAN VIRAL TIKTOK 2022 JEDAG JEDUG FULL BASS TERBARU (1).mp3 | 2022-08-07 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | deaaa.mp3 | 2022-08-07 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | WindRoseDiggyDiggyHole64868093.mp3 | 2022-08-07 17:06 | 0 | |
![[SND]](/icons/sound2.gif) | 04.mp3 | 2022-08-07 17:04 | 1.3M | |
![[SND]](/icons/sound2.gif) | daa.mp3 | 2022-08-07 17:03 | 0 | |
![[SND]](/icons/sound2.gif) | diverfon.mp3 | 2022-08-07 17:02 | 0 | |
![[SND]](/icons/sound2.gif) | demtan.mp3 | 2022-08-07 17:00 | 0 | |
![[SND]](/icons/sound2.gif) | saddamm.mp3 | 2022-08-07 16:55 | 960K | |
![[SND]](/icons/sound2.gif) | luffy1.mp3 | 2022-08-07 16:54 | 0 | |
![[SND]](/icons/sound2.gif) | DJz.mp3 | 2022-08-07 16:50 | 0 | |
![[SND]](/icons/sound2.gif) | thumbi.mp3 | 2022-08-07 16:49 | 0 | |
![[SND]](/icons/sound2.gif) | Sunset.mp3 | 2022-08-07 16:40 | 0 | |
![[SND]](/icons/sound2.gif) | kopet.mp3 | 2022-08-07 16:39 | 0 | |
![[SND]](/icons/sound2.gif) | XyorXzz.mp3 | 2022-08-07 16:35 | 0 | |
![[SND]](/icons/sound2.gif) | vikraem.mp3 | 2022-08-07 16:33 | 0 | |
![[SND]](/icons/sound2.gif) | yt1s.io - (Drunk in a shaappu) മലയാളം song remix (DJ MALAYALAM) drank song BOOSTED BASS By SKULL FORCE (128 kbps).mp3 | 2022-08-07 16:30 | 0 | |
![[SND]](/icons/sound2.gif) | vikrem.mp3 | 2022-08-07 16:26 | 0 | |
![[SND]](/icons/sound2.gif) | KiwKiw1.mp3 | 2022-08-07 16:24 | 0 | |
![[SND]](/icons/sound2.gif) | Sad6.mp3 | 2022-08-07 16:24 | 1.1M | |
![[SND]](/icons/sound2.gif) | Sad4.mp3 | 2022-08-07 16:23 | 5.8M | |
![[SND]](/icons/sound2.gif) | Dhije24.mp3 | 2022-08-07 16:23 | 0 | |
![[SND]](/icons/sound2.gif) | Har.mp3 | 2022-08-07 16:22 | 0 | |
![[SND]](/icons/sound2.gif) | EMEL.mp3 | 2022-08-07 16:21 | 4.7M | |
![[SND]](/icons/sound2.gif) | Har Har Shambhu Ringtone_320(PagalWorld.com.se).mp3 | 2022-08-07 16:20 | 0 | |
![[SND]](/icons/sound2.gif) | Dhijee29.mp3 | 2022-08-07 16:20 | 0 | |
![[SND]](/icons/sound2.gif) | Ajith2.mp3 | 2022-08-07 16:17 | 0 | |
![[SND]](/icons/sound2.gif) | lemon.mp3 | 2022-08-07 16:16 | 1.9M | |
![[SND]](/icons/sound2.gif) | Ajith1.mp3 | 2022-08-07 16:14 | 848K | |
![[SND]](/icons/sound2.gif) | y2mate.com - Keisya Levronka Tak Ingin Usai Official Music Video.mp3 | 2022-08-07 16:08 | 0 | |
![[SND]](/icons/sound2.gif) | TDYSG1.mp3 | 2022-08-07 16:06 | 0 | |
![[SND]](/icons/sound2.gif) | Reality.mp3 | 2022-08-07 16:06 | 0 | |
![[SND]](/icons/sound2.gif) | IFA.mp3 | 2022-08-07 16:05 | 0 | |
![[SND]](/icons/sound2.gif) | Soft.mp3 | 2022-08-07 16:05 | 0 | |
![[SND]](/icons/sound2.gif) | DUDE120.mp3 | 2022-08-07 16:04 | 0 | |
![[SND]](/icons/sound2.gif) | DjOld.mp3 | 2022-08-07 16:03 | 0 | |
![[SND]](/icons/sound2.gif) | OneDirection1.mp3 | 2022-08-07 16:01 | 0 | |
![[SND]](/icons/sound2.gif) | meong.mp3 | 2022-08-07 15:58 | 0 | |
![[SND]](/icons/sound2.gif) | pup.mp3 | 2022-08-07 15:58 | 0 | |
![[SND]](/icons/sound2.gif) | 02.mp3 | 2022-08-07 15:58 | 18M | |
![[SND]](/icons/sound2.gif) | SARAK1.mp3 | 2022-08-07 15:48 | 1.9M | |
![[SND]](/icons/sound2.gif) | 128-Why This Kolaveri Di (The Soup of Love) - 3 128 Kbps.mp3 | 2022-08-07 15:41 | 0 | |
![[SND]](/icons/sound2.gif) | semalam1.mp3 | 2022-08-07 15:40 | 0 | |
![[SND]](/icons/sound2.gif) | XXX.mp3 | 2022-08-07 15:40 | 300K | |
![[SND]](/icons/sound2.gif) | Hank1.mp3 | 2022-08-07 15:39 | 4.0M | |
![[SND]](/icons/sound2.gif) | DjSoft.mp3 | 2022-08-07 15:39 | 0 | |
![[SND]](/icons/sound2.gif) | Endshpil_Oj_oj_oj_nesi_menya_moya_doroga.mp3 | 2022-08-07 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | ya69.mp3 | 2022-08-07 15:36 | 0 | |
![[SND]](/icons/sound2.gif) | didto.mp3 | 2022-08-07 15:36 | 0 | |
![[SND]](/icons/sound2.gif) | Pflegekennzeichnung.mp3 | 2022-08-07 15:35 | 0 | |
![[SND]](/icons/sound2.gif) | A Pimp Named Slickback.mp3 | 2022-08-07 15:34 | 0 | |
![[SND]](/icons/sound2.gif) | yt1s.com - Rollinin In The Rearview Headbone ft Jabu Cars Delinquent Road Hazards Song HD 2 1 Audio.mp3 | 2022-08-07 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | miyagi-jendshpil-feat.-9-gramm-rapapam.mp3 | 2022-08-07 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | tm23.mp3 | 2022-08-07 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | tm14.mp3 | 2022-08-07 15:32 | 4.1M | |
![[SND]](/icons/sound2.gif) | tm20.mp3 | 2022-08-07 15:32 | 4.4M | |
![[SND]](/icons/sound2.gif) | tm17.mp3 | 2022-08-07 15:32 | 6.5M | |
![[SND]](/icons/sound2.gif) | tm19.mp3 | 2022-08-07 15:32 | 3.3M | |
![[SND]](/icons/sound2.gif) | tm18.mp3 | 2022-08-07 15:32 | 2.4M | |
![[SND]](/icons/sound2.gif) | tm15.mp3 | 2022-08-07 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | tm10.mp3 | 2022-08-07 15:32 | 3.7M | |
![[SND]](/icons/sound2.gif) | tm13.mp3 | 2022-08-07 15:32 | 3.0M | |
![[SND]](/icons/sound2.gif) | tm12.mp3 | 2022-08-07 15:32 | 4.7M | |
![[SND]](/icons/sound2.gif) | tm9.mp3 | 2022-08-07 15:32 | 2.8M | |
![[SND]](/icons/sound2.gif) | tm11.mp3 | 2022-08-07 15:32 | 4.1M | |
![[SND]](/icons/sound2.gif) | tm8.mp3 | 2022-08-07 15:32 | 2.9M | |
![[SND]](/icons/sound2.gif) | tm5.mp3 | 2022-08-07 15:32 | 7.3M | |
![[SND]](/icons/sound2.gif) | tm6.mp3 | 2022-08-07 15:32 | 6.7M | |
![[SND]](/icons/sound2.gif) | tm7.mp3 | 2022-08-07 15:32 | 3.4M | |
![[SND]](/icons/sound2.gif) | tm4.mp3 | 2022-08-07 15:32 | 8.8M | |
![[SND]](/icons/sound2.gif) | tm3.mp3 | 2022-08-07 15:32 | 6.6M | |
![[SND]](/icons/sound2.gif) | tm2.mp3 | 2022-08-07 15:32 | 7.7M | |
![[SND]](/icons/sound2.gif) | tm1.mp3 | 2022-08-07 15:32 | 10M | |
![[SND]](/icons/sound2.gif) | Sepaa.mp3 | 2022-08-07 15:31 | 0 | |
![[SND]](/icons/sound2.gif) | Beautifuliw.mp3 | 2022-08-07 15:28 | 0 | |
![[SND]](/icons/sound2.gif) | johns.mp3 | 2022-08-07 15:27 | 0 | |
![[SND]](/icons/sound2.gif) | Before.mp3 | 2022-08-07 15:24 | 0 | |
![[SND]](/icons/sound2.gif) | SEE70.mp3 | 2022-08-07 15:23 | 0 | |
![[SND]](/icons/sound2.gif) | Riddle Relient K cover.mp3 | 2022-08-07 15:22 | 0 | |
![[SND]](/icons/sound2.gif) | Miyagi_Simptom_-_Lyubi_menya_47829531.mp3 | 2022-08-07 15:22 | 0 | |
![[SND]](/icons/sound2.gif) | Good12.mp3 | 2022-08-07 15:18 | 0 | |
![[SND]](/icons/sound2.gif) | arctic monkeys — why'd you only call me when you're high (slightly slowed) (www.lightaudio.ru).mp3 | 2022-08-07 15:17 | 0 | |
![[SND]](/icons/sound2.gif) | Slippy & Blosso - Horizon (Back To Life) [Official Instrumental].mp3 | 2022-08-07 15:16 | 0 | |
![[SND]](/icons/sound2.gif) | Instasamka_Хлопай_[BASS BOOSTED]_(256_kbps).mp3 | 2022-08-07 15:16 | 0 | |
![[SND]](/icons/sound2.gif) | Neizvestnyjj_-_INSTASAMKA-KHLOPAJJ_BASS_BOOST_73386954 (1).mp3 | 2022-08-07 15:16 | 0 | |
![[SND]](/icons/sound2.gif) | Wuxa Song.mp3 | 2022-08-07 15:15 | 0 | |
![[SND]](/icons/sound2.gif) | Chase_Atlantic_-_CALL_ME_BACK_73217790.mp3 | 2022-08-07 15:15 | 0 | |
![[SND]](/icons/sound2.gif) | decemberave.mp3 | 2022-08-07 15:15 | 0 | |
![[SND]](/icons/sound2.gif) | 7! (mp3cut.net).mp3 | 2022-08-07 15:15 | 0 | |
![[SND]](/icons/sound2.gif) | naz.mp3 | 2022-08-07 15:14 | 0 | |
![[SND]](/icons/sound2.gif) | Hero12.mp3 | 2022-08-07 15:14 | 0 | |
![[SND]](/icons/sound2.gif) | Beautiful in white (.mp3 | 2022-08-07 15:13 | 0 | |
![[SND]](/icons/sound2.gif) | Instasamka - Хлопай [BASS BOOSTED] (256 kbps).mp3 | 2022-08-07 15:13 | 3.4M | |
![[SND]](/icons/sound2.gif) | DUDE116.mp3 | 2022-08-07 15:07 | 3.3M | |
![[SND]](/icons/sound2.gif) | john_mayer_you_re_gonna_live_forever_in_me_audio_4683622890228229170.mp3 | 2022-08-07 15:06 | 0 | |
![[SND]](/icons/sound2.gif) | DUDE95.mp3 | 2022-08-07 15:06 | 3.7M | |
![[SND]](/icons/sound2.gif) | mercury.mp3 | 2022-08-07 15:04 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - One Direction Night Changes Lyrics.mp3 | 2022-08-07 15:04 | 2.7M | |
![[SND]](/icons/sound2.gif) | dije1.mp3 | 2022-08-07 15:03 | 3.8M | |
![[SND]](/icons/sound2.gif) | Avraham (1).mp3 | 2022-08-07 15:01 | 0 | |
![[SND]](/icons/sound2.gif) | alina-shakieva-ujkym-kelmejdi_(muzstars.kz).mp3 | 2022-08-07 15:01 | 0 | |
![[SND]](/icons/sound2.gif) | Lil.mp3 | 2022-08-07 15:00 | 0 | |
![[SND]](/icons/sound2.gif) | FizGegeh.mp3 | 2022-08-07 14:59 | 0 | |
![[SND]](/icons/sound2.gif) | DUDE98.mp3 | 2022-08-07 14:58 | 2.6M | |
![[SND]](/icons/sound2.gif) | DUDE97.mp3 | 2022-08-07 14:58 | 4.6M | |
![[SND]](/icons/sound2.gif) | DUDE90.mp3 | 2022-08-07 14:58 | 2.0M | |
![[SND]](/icons/sound2.gif) | DUDE93.mp3 | 2022-08-07 14:58 | 3.3M | |
![[SND]](/icons/sound2.gif) | DUDE94.mp3 | 2022-08-07 14:58 | 4.4M | |
![[SND]](/icons/sound2.gif) | DUDE99.mp3 | 2022-08-07 14:58 | 2.5M | |
![[SND]](/icons/sound2.gif) | DUDE96.mp3 | 2022-08-07 14:58 | 2.6M | |
![[SND]](/icons/sound2.gif) | DUDE84.mp3 | 2022-08-07 14:58 | 5.0M | |
![[SND]](/icons/sound2.gif) | DUDE91.mp3 | 2022-08-07 14:58 | 3.4M | |
![[SND]](/icons/sound2.gif) | DUDE9.mp3 | 2022-08-07 14:58 | 3.5M | |
![[SND]](/icons/sound2.gif) | DUDE92.mp3 | 2022-08-07 14:58 | 2.4M | |
![[SND]](/icons/sound2.gif) | DUDE89.mp3 | 2022-08-07 14:58 | 3.0M | |
![[SND]](/icons/sound2.gif) | DUDE88.mp3 | 2022-08-07 14:58 | 2.9M | |
![[SND]](/icons/sound2.gif) | DUDE81.mp3 | 2022-08-07 14:58 | 3.9M | |
![[SND]](/icons/sound2.gif) | DUDE83.mp3 | 2022-08-07 14:58 | 3.5M | |
![[SND]](/icons/sound2.gif) | DUDE87.mp3 | 2022-08-07 14:58 | 2.4M | |
![[SND]](/icons/sound2.gif) | DUDE85.mp3 | 2022-08-07 14:58 | 2.4M | |
![[SND]](/icons/sound2.gif) | DUDE86.mp3 | 2022-08-07 14:58 | 2.5M | |
![[SND]](/icons/sound2.gif) | DUDE82.mp3 | 2022-08-07 14:58 | 2.5M | |
![[SND]](/icons/sound2.gif) | haylee.mp3 | 2022-08-07 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | Mar.mp3 | 2022-08-07 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | youandi.mp3 | 2022-08-07 14:56 | 0 | |
![[SND]](/icons/sound2.gif) | Mon.mp3 | 2022-08-07 14:56 | 1.4M | |
![[SND]](/icons/sound2.gif) | Remixer12.mp3 | 2022-08-07 14:55 | 0 | |
![[SND]](/icons/sound2.gif) | DUDE79.mp3 | 2022-08-07 14:55 | 3.7M | |
![[SND]](/icons/sound2.gif) | DUDE80.mp3 | 2022-08-07 14:55 | 3.0M | |
![[SND]](/icons/sound2.gif) | DUDE78.mp3 | 2022-08-07 14:55 | 3.2M | |
![[SND]](/icons/sound2.gif) | DUDE8.mp3 | 2022-08-07 14:55 | 2.1M | |
![[SND]](/icons/sound2.gif) | DUDE77.mp3 | 2022-08-07 14:55 | 3.8M | |
![[SND]](/icons/sound2.gif) | DUDE74.mp3 | 2022-08-07 14:55 | 4.3M | |
![[SND]](/icons/sound2.gif) | DUDE70.mp3 | 2022-08-07 14:55 | 3.9M | |
![[SND]](/icons/sound2.gif) | DUDE76.mp3 | 2022-08-07 14:55 | 2.3M | |
![[SND]](/icons/sound2.gif) | lalove1.mp3 | 2022-08-07 14:55 | 0 | |
![[SND]](/icons/sound2.gif) | DUDE73.mp3 | 2022-08-07 14:55 | 2.9M | |
![[SND]](/icons/sound2.gif) | DUDE75.mp3 | 2022-08-07 14:55 | 3.7M | |
![[SND]](/icons/sound2.gif) | DUDE66.mp3 | 2022-08-07 14:55 | 3.0M | |
![[SND]](/icons/sound2.gif) | DUDE71.mp3 | 2022-08-07 14:55 | 2.3M | |
![[SND]](/icons/sound2.gif) | DUDE6.mp3 | 2022-08-07 14:55 | 7.5M | |
![[SND]](/icons/sound2.gif) | DUDE72.mp3 | 2022-08-07 14:55 | 2.5M | |
![[SND]](/icons/sound2.gif) | DUDE69.mp3 | 2022-08-07 14:55 | 2.8M | |
![[SND]](/icons/sound2.gif) | DUDE7.mp3 | 2022-08-07 14:55 | 1.5M | |
![[SND]](/icons/sound2.gif) | DUDE67.mp3 | 2022-08-07 14:55 | 2.0M | |
![[SND]](/icons/sound2.gif) | DUDE65.mp3 | 2022-08-07 14:55 | 3.0M | |
![[SND]](/icons/sound2.gif) | DUDE60.mp3 | 2022-08-07 14:55 | 3.4M | |
![[SND]](/icons/sound2.gif) | DUDE64.mp3 | 2022-08-07 14:55 | 3.4M | |
![[SND]](/icons/sound2.gif) | DUDE63.mp3 | 2022-08-07 14:55 | 3.7M | |
![[SND]](/icons/sound2.gif) | DUDE68.mp3 | 2022-08-07 14:55 | 2.4M | |
![[SND]](/icons/sound2.gif) | DUDE62.mp3 | 2022-08-07 14:55 | 2.0M | |
![[SND]](/icons/sound2.gif) | DUDE61.mp3 | 2022-08-07 14:55 | 2.9M | |
![[SND]](/icons/sound2.gif) | DUDE |