Index of /

[ICO]NameLast modifiedSizeDescription

[SND]Tren Sexual (letra) _ Pedro Suárez Vértiz (320 kbps).mp32022-08-13 04:02 0  
[SND]roxette - Itu0027s Possible Version One lyrics (YTCONVERT.IN).mp32022-08-13 04:01 0  
[SND]DJ_NO_COMMENT_TUTY_WIBOWO_SOUND_RULL_𝐏𝐑𝐄𝐒𝐄𝐓_VIRAL_FYP_T_n4HqwThT094 (1).mp32022-08-13 04:01 0  
[SND]OnlyMP3.to - Inscryption OST 23 - G0lly's Theme (Uploading)-WHi6TMmQaO0-192k-1643515093319.mp32022-08-13 04:00 0  
[SND]PALOMA AJENA - Aguamarina (YTCONVERT.IN).mp32022-08-13 04:00 0  
[SND]holiday.mp32022-08-13 03:58 1.1M 
[SND]BDM.mp32022-08-13 03:57 0  
[SND]stack game bgm.mp32022-08-13 03:52 0  
[SND]No One Else.mp32022-08-13 03:49 0  
[SND]c3bdb5b8e5ebd8e9a8a84e38f84f879c.mp32022-08-13 03:48 0  
[SND]dem.mp32022-08-13 03:46 0  
[SND]Dj2.mp32022-08-13 03:44 2.4M 
[SND]Until.mp32022-08-13 03:41 1.7M 
[SND]mp21.mp32022-08-13 03:39 3.4M 
[SND]black.mp32022-08-13 03:38 2.4M 
[SND]mp18.mp32022-08-13 03:37 5.7M 
[SND]ruok.mp32022-08-13 03:37 0  
[SND]regards.mp32022-08-13 03:35 0  
[SND]pal.mp32022-08-13 03:35 0  
[SND]sick.mp32022-08-13 03:35 0  
[SND]mp19.mp32022-08-13 03:33 136K 
[SND]mp30.mp32022-08-13 03:31 0  
[SND]P.P.P.mp32022-08-13 03:31 0  
[SND]mixkit-message-pop-alert-2354.mp32022-08-13 03:30 46K 
[SND]mp23.mp32022-08-13 03:30 0  
[SND]V4.mp32022-08-13 03:29 3.3M 
[SND]mp22.mp32022-08-13 03:27 4.7M 
[SND]BDM1.mp32022-08-13 03:27 104K 
[SND]Dj1.mp32022-08-13 03:26 1.1M 
[SND]Arms.mp32022-08-13 03:20 0  
[SND]Abang.mp32022-08-13 03:20 0  
[SND]Alsa.mp32022-08-13 03:19 0  
[SND]Lonte1.mp32022-08-13 03:19 0  
[SND]Kemerdekaan.mp32022-08-13 03:19 0  
[SND]SBD12.mp32022-08-13 03:19 0  
[SND]Funkot1.mp32022-08-13 03:18 0  
[SND]Enakniam12.mp32022-08-13 03:17 0  
[SND]andrew.mp32022-08-13 03:11 3.2M 
[VID]Lost (1).mp42022-08-13 03:08 0  
[SND]S6.mp32022-08-13 03:04 2.7M 
[SND]S5.mp32022-08-13 03:04 3.3M 
[SND]S3.mp32022-08-13 03:03 2.4M 
[SND]S4.mp32022-08-13 03:03 3.6M 
[SND]S2.mp32022-08-13 03:03 2.4M 
[SND]S1.mp32022-08-13 03:03 1.5M 
[SND]y2mate.com - Lagu Kemerdekaan RI 17 Agustus 1945.mp32022-08-13 03:01 168K 
[SND]20.mp32022-08-13 03:01 7.0M 
[SND]Test.mp32022-08-13 02:56 256K 
[SND]ROBBERY.mp32022-08-13 02:55 0  
[SND]stay.mp32022-08-13 02:49 2.4M 
[SND]Moon.mp32022-08-13 02:49 3.5M 
[SND]Last night.mp32022-08-13 02:48 0  
[SND]Gtw.mp32022-08-13 02:48 0  
[SND]kagome.mp32022-08-13 02:48 3.7M 
[SND]Falz.mp32022-08-13 02:48 0  
[SND]VP7.mp32022-08-13 02:47 0  
[SND]Grandfather Time.mp32022-08-13 02:46 0  
[SND]29_sua_01.mp32022-08-13 02:42 0  
[SND]海伦 - 画离弦.mp32022-08-13 02:40 0  
[SND]Stay.mp32022-08-13 02:40 1.9M 
[SND]LXSTODIUMmusic.mp32022-08-13 02:27 0  
[SND]pesni_dly_barvifi.mp32022-08-13 02:21 1.2M 
[SND]mmk.mp32022-08-13 02:17 1.8M 
[SND]asu.mp32022-08-13 02:17 1.5M 
[SND]TakeMeHome.mp32022-08-13 02:08 0  
[SND]Maybe.mp32022-08-13 02:08 0  
[SND]X2Download.app - BURUH TANI - MARJINAL __ COVER BY REGITA ECHA (LYRIC) (64 kbps).mp32022-08-13 02:02 0  
[SND]fallen kingdom.mp32022-08-13 02:02 0  
[SND]lgw.mp32022-08-13 01:58 0  
[SND]12082022 - FUNABASHI DAYLIGHT ARCHIE COVER.mp32022-08-13 01:56 0  
[SND]12082022 - public domain archie edit_2.mp32022-08-13 01:55 0  
[SND]12082022- 26032022.mp32022-08-13 01:55 0  
[SND]12082022 - no name_2.mp32022-08-13 01:55 0  
[SND]12082022 - TECHENKO 200821.mp32022-08-13 01:55 0  
[SND]12082022 - FEDO - BE ORIGINAL (ARCHIE DUB).mp32022-08-13 01:54 0  
[SND]Mb.mp32022-08-13 01:54 0  
[SND]12082022 - 27112021.mp32022-08-13 01:54 0  
[SND]12082022 - ARCHIE ID.mp32022-08-13 01:54 0  
[SND]12082022 - riverside.mp32022-08-13 01:54 0  
[SND]12082022 - fest_rozpruwacz_dupy.mp32022-08-13 01:53 0  
[SND]12082022 - ARCHIE FT EQUINOX LAST ONE TO DIE.mp32022-08-13 01:53 0  
[SND]12082022 - 01022022.mp32022-08-13 01:53 0  
[SND]12082022 - 27032022tech-pigeon.mp32022-08-13 01:53 0  
[SND]12082022 - 21112020.mp32022-08-13 01:53 0  
[SND]12082022 - 18112020 intro edm.mp32022-08-13 01:52 0  
[SND]12082022 - 02042022.mp32022-08-13 01:52 0  
[SND]لا تنسي الاشتراك في القناة.mp32022-08-13 01:45 0  
[VID]QO.mp42022-08-13 01:43 0  
[VID]Vp5.mp42022-08-13 01:42 0  
[SND]QO.mp32022-08-13 01:37 2.8M 
[SND]TOT.mp32022-08-13 01:36 0  
[SND]Vp5.mp32022-08-13 01:35 80K 
[SND]TO.mp32022-08-13 01:34 4.3M 
[SND]OT.mp32022-08-13 01:33 0  
[SND]TR.mp32022-08-13 01:30 200K 
[SND]Vp7.mp32022-08-13 01:28 0  
[SND]big-baby-tape-kizaru-bandana-mp3.mp32022-08-13 01:27 0  
[SND]Vp6.mp32022-08-13 01:26 384K 
[SND]Recording (5).mp32022-08-13 01:18 0  
[SND]Vp2.mp32022-08-13 01:18 2.0M 
[SND]QC.mp32022-08-13 01:17 0  
[SND]QR.mp32022-08-13 01:16 0  
[SND]y2mate.com - Rain Noise Rain Sound Effect No Copyright Nature Sounds720P HD.mp32022-08-13 01:15 0  
[SND]BM.mp32022-08-13 01:15 0  
[SND]sunrf.mp32022-08-13 01:12 0  
[SND]OQ.mp32022-08-13 01:11 1.3M 
[SND]DO.mp32022-08-13 01:08 0  
[SND]DR.mp32022-08-13 01:07 0  
[SND]k10.mp32022-08-13 01:06 1.0M 
[SND]DH.mp32022-08-13 01:05 0  
[SND]DD.mp32022-08-13 01:02 3.5M 
[SND]DJ.mp32022-08-13 01:00 0  
[SND]k7.mp32022-08-13 00:51 0  
[SND]S23.mp32022-08-13 00:46 0  
[SND]S25.mp32022-08-13 00:46 0  
[SND]S24.mp32022-08-13 00:46 0  
[SND]S22.mp32022-08-13 00:46 0  
[SND]S21.mp32022-08-13 00:46 0  
[SND]S20.mp32022-08-13 00:46 0  
[SND]Faizan1.mp32022-08-13 00:43 0  
[SND]أغنية مضحكة أمازيغية(MP3_320K).mp32022-08-13 00:38 0  
[SND]k9.mp32022-08-13 00:37 5.1M 
[SND]2022.mp32022-08-13 00:35 3.5M 
[SND]k8.mp32022-08-13 00:32 0  
[SND]tian.mp32022-08-13 00:24 0  
[SND]Mourad Majjoud - Jibi Police ( Ayli Ayli ) مراد مجود - جيبي البوليس(MP3_320K).mp32022-08-13 00:20 0  
[SND]d.mp32022-08-13 00:11 3.1M 
[SND]BEN0.mp32022-08-13 00:11 0  
[SND]bellucci🇮🇹 _ inst_1nurovv - шахрезад «remix» (www.hotplayer.ru).mp32022-08-13 00:09 0  
[SND]prom.mp32022-08-13 00:09 1.8M 
[SND]hamil.mp32022-08-13 00:08 1.7M 
[SND]Cooking_ Great! - The Legend of Zelda_ Breath of the Wild Sound Effect (128 kbps).mp32022-08-13 00:08 0  
[SND]apakabarsayang.mp32022-08-13 00:06 0  
[SND]19.mp32022-08-12 23:58 1.2M 
[SND]samp.mp32022-08-12 23:52 4.1M 
[SND]ToiMuonYeuMotNguoi-KhoiMy-5550418.mp32022-08-12 23:50 0  
[SND]shade rex.mp32022-08-12 23:42 0  
[SND]maanghang.mp32022-08-12 23:39 0  
[SND]M.I.B JAK.mp32022-08-12 23:34 0  
[SND]ssstik.io_1660346521753.mp32022-08-12 23:25 0  
[SND]In Game Music Suite (Zuma Deluxe).mp32022-08-12 23:18 0  
[SND]Убей меня, Эйс! – Милая трагедия.mp32022-08-12 23:11 0  
[SND]ktt.mp32022-08-12 23:07 0  
[SND]vp10.mp32022-08-12 23:02 0  
[SND]Vp3.mp32022-08-12 22:57 2.5M 
[SND]Hal18.mp32022-08-12 22:47 0  
[SND]akucoba.m4a2022-08-12 22:39 0  
[SND]misha-xramovi-vigimi-mp3.mp32022-08-12 22:32 0  
[SND]Dhikaa61.mp32022-08-12 22:31 0  
[SND]tagne.mp32022-08-12 22:25 0  
[SND]Dere - Berisik (lirik).mp32022-08-12 22:23 0  
[SND]Dhikaa4.mp32022-08-12 22:21 0  
[SND]Cover1.mp32022-08-12 22:21 0  
[SND]Cover2.mp32022-08-12 22:21 0  
[SND]manu_chao_me_gustas_tu_speed_up-mob4ik.com.mp32022-08-12 22:20 716K 
[SND]ya.mp32022-08-12 22:20 3.0M 
[SND]Budi Doremi - Melukis Senja (Official Video).mp32022-08-12 22:19 0  
[SND]CG5 — Mommy's Here (www.lightaudio.ru).mp32022-08-12 22:17 0  
[SND]cover2.mp32022-08-12 22:14 0  
[SND]cover1.mp32022-08-12 22:14 0  
[SND]Dhikaa6.mp32022-08-12 22:11 0  
[SND]Audio Message M.mp32022-08-12 22:11 304K 
[SND]Anthony Zhang.mp32022-08-12 22:05 0  
[SND]AZhangWhisky.mp32022-08-12 21:59 0  
[SND]AZhang.mp32022-08-12 21:55 0  
[SND]Jose ++Elvis Presley .mp32022-08-12 21:48 7.0M 
[SND]Anthony Zhang 1.mp32022-08-12 21:43 0  
[SND]Aarne_Tesno_Feat_BUSHIDO_ZHO_ANIKV.mp32022-08-12 21:41 0  
[SND]DARK1.mp32022-08-12 21:40 0  
[SND]Matre-gims-bella_[www.Bisyor.me].mp32022-08-12 21:36 0  
[SND]nk.mp32022-08-12 21:33 0  
[SND]1.mp32022-08-12 21:33 0  
[SND]morgenshtern-show-club-remix.mp32022-08-12 21:33 0  
[SND]Morgenshtern_Show_Sever_remix.mp32022-08-12 21:31 0  
[SND]Adam Lapierre Director of Wine Vint.mp32022-08-12 21:27 184K 
[SND]VK.mp32022-08-12 21:25 2.4M 
[SND]RR (1).mp32022-08-12 21:23 0  
[SND]RR.mp32022-08-12 21:23 2.1M 
[SND]Anthony Zhang, Vinovest Cofounder CEO answering What has made whiskey one of the best-performing assets of 2022.mp32022-08-12 21:14 0  
[SND]JOMBLO2.mp32022-08-12 21:13 4.0K 
[SND]murat-tkhagalegov-chuzhaja-nevesta.mp32022-08-12 21:04 0  
[SND]The Cad.mp32022-08-12 21:03 0  
[SND]Armağan Oruç - Gun Double.mp32022-08-12 20:58 0  
[SND]Мурат Тхагалегов - Чужая невеста (mp3store.cc).mp32022-08-12 20:55 0  
[SND]DINOAZ-1.mp32022-08-12 20:54 0  
[SND]Барбарики - PHONK REMIX (mp3-2020.com).mp32022-08-12 20:53 1.1M 
[SND]DINO_AZ1.mp32022-08-12 20:51 0  
[SND]Duki - GIVENCHY x Hello Cotto ( Mashup ) ( DJ Hummer Remix ) .mp32022-08-12 20:44 0  
[SND]faydademo.mp32022-08-12 20:43 0  
[SND]Over_the_Horizon.mp32022-08-12 20:33 0  
[SND]PlayaPhonk_-_Phonky_Town_72969550.mp32022-08-12 20:33 0  
[SND]KSLV_Noh_-_Disaster_73210675.mp32022-08-12 20:32 0  
[SND]KSLV_Noh_-_Override_slowed_reverb_74103963.mp32022-08-12 20:32 0  
[SND]Jxid1.mp32022-08-12 20:31 0  
[SND]DISASTER_-_KSLV_Noh_slowed_reverb_320_kbps_73321634.mp32022-08-12 20:31 0  
[SND]MyBe1.mp32022-08-12 20:27 0  
[SND]y2mate.com - Lil Uzi Vert 20 Min.mp32022-08-12 20:24 0  
[SND]Snoop_Dogg_Dr_Dre_-_Still_DRE_47964903.mp32022-08-12 20:23 10M 
[SND]y2mate.com - Playboi Carti Sky Official Audio.mp32022-08-12 20:22 0  
[SND]Dj Azik - Chuchuka (mp3store.cc).mp32022-08-12 20:21 0  
[SND]Dj Azik - Chuchuka (mp3store.cc) (1).mp32022-08-12 20:19 0  
[VID]audioclip-1659980429000-81000.mp42022-08-12 20:18 0  
[SND]vincent.mp32022-08-12 20:18 0  
[SND]danzakudurox.mp32022-08-12 20:11 0  
[SND]CuihX1.mp32022-08-12 20:10 0  
[SND]Три дня дождя - Неважно_(tropicmusic.ru).mp32022-08-12 20:08 0  
[SND]HayukLagu1.mp32022-08-12 20:07 0  
[SND]bili.mp32022-08-12 20:05 0  
[SND]KNOCK.mp32022-08-12 20:03 0  
[SND]MpE1.mp32022-08-12 20:01 0  
[SND]iniperludienter1 mp3_13-08-22_03-44-05-234.mp32022-08-12 20:01 0  
[SND]Три дня дождя - Неважно.mp32022-08-12 19:58 0  
[SND]yoreyes1.mp32022-08-12 19:54 0  
[SND]Don-Omar-feat-Tego-Calderon_-_Bandaleros-ost-Troynoy-forsazh-Tokiyskiy-drift_(mp3home.me).mp32022-08-12 19:48 0  
[SND]sasa.mp32022-08-12 19:44 0  
[SND]sasa1.mp32022-08-12 19:43 0  
[SND]Sokin1.mp32022-08-12 19:43 0  
[SND]y2mate.com - YG Toxic_320kbps.mp32022-08-12 19:42 0  
[SND]rub.mp32022-08-12 19:38 0  
[SND]Da.mp32022-08-12 19:33 0  
[SND]lana_del_rei_x_coolio_-_remix_sickick_(muzrecord.com).mp32022-08-12 19:32 6.4M 
[SND]Aa.mp32022-08-12 19:32 7.3M 
[SND]Aranc Qez.mp32022-08-12 19:31 0  
[SND]AUD-20220812-WA0017.m4a2022-08-12 19:31 0  
[SND]master.mp32022-08-12 19:27 0  
[SND]palak1.mp32022-08-12 19:26 0  
[SND]Byansi by Collins.mp32022-08-12 19:25 3.5M 
[SND]collins- hellen mastered[HMRecords]0753486667.mp32022-08-12 19:23 0  
[SND]ℂ𝕦𝕓𝕒𝕖𝕤𝕤-🎟-kissvk.com.mp32022-08-12 19:22 0  
[SND]sentimental.mp32022-08-12 19:21 0  
[SND]Yoi1.mp32022-08-12 19:20 0  
[SND]BetterDays.mp32022-08-12 19:19 4.6M 
[VID]videoplayback.mp42022-08-12 19:19 4.0M 
[SND]LostSky.mp32022-08-12 19:18 0  
[SND]Breezeblocks.mp32022-08-12 19:14 0  
[SND]Dark_Souls_OST_-_Sif_velikij_volk_(Gybka.com).mp32022-08-12 19:13 0  
[SND]Alt-J (∆) _ Breezeblocks Lyrics (HQ).mp32022-08-12 19:12 0  
[SND]FIL1.mp32022-08-12 19:12 0  
[SND]Dhije2.mp32022-08-12 19:11 3.9M 
[SND]Sok3.mp32022-08-12 19:09 0  
[SND]Sok2.mp32022-08-12 19:04 0  
[SND]selamatulangtahun.mp32022-08-12 19:03 0  
[SND]Sokin2.mp32022-08-12 19:02 0  
[SND]MaMu2.mp32022-08-12 18:56 0  
[SND]IUIH.mp32022-08-12 18:51 0  
[SND]lucifer_call_me_devil.mp32022-08-12 18:49 0  
[SND]TryMitis.mp32022-08-12 18:48 0  
[SND]lucifer_call_me_devil_-5547512551233268271.mp32022-08-12 18:48 0  
[SND]Vr.mp32022-08-12 18:47 0  
[SND]Gustixa_-_lemon_tree(256k).mp32022-08-12 18:41 0  
[SND]7063826647098641178.mp32022-08-12 18:39 0  
[SND]D GERRARD - นักวิทยาศาสตร์ (Scientist) (Lyrics).mp32022-08-12 18:38 0  
[SND]lukku11.mp32022-08-12 18:37 0  
[SND]y2mate.com - Gellen Martadinata Selamat Ulang Tahun cover by Moyy.mp32022-08-12 18:37 0  
[SND]yt.mp32022-08-12 18:35 0  
[SND]!positive.mp32022-08-12 18:34 0  
[SND]Vp1.mp32022-08-12 18:33 80K 
[SND]big-baby-tape-kizaru-so-icy-nihao-file.mp32022-08-12 18:29 0  
[SND]b13ftw.mp32022-08-12 18:26 0  
[SND]TOBA1.mp32022-08-12 18:25 424K 
[SND]W.mp32022-08-12 18:22 3.5M 
[VID]Cukup Dikenang Saja.mp42022-08-12 18:22 0  
[SND]4.mp32022-08-12 18:20 2.0M 
[SND]DuaLipa.mp32022-08-12 18:18 0  
[SND]Платина feat OG Buda, MAYOT - Abu Dhabi Ba6y.mp32022-08-12 18:17 0  
[SND]1234.mp32022-08-12 18:17 0  
[SND]50.mp32022-08-12 18:15 0  
[SND]123.mp32022-08-12 18:15 2.4M 
[SND]100.mp32022-08-12 18:15 3.3M 
[SND]111.mp32022-08-12 18:15 2.0M 
[SND]31.mp32022-08-12 18:14 1.5M 
[SND]29.mp32022-08-12 18:14 2.4M 
[SND]24.mp32022-08-12 18:14 144K 
[SND]25.mp32022-08-12 18:14 1.0M 
[SND]28.mp32022-08-12 18:14 2.0M 
[SND]26.mp32022-08-12 18:13 1.7M 
[SND]9.mp32022-08-12 18:13 2.4M 
[SND]Whistle.mp32022-08-12 18:13 4.0M 
[SND]Youth.mp32022-08-12 18:13 3.1M 
[SND]5.mp32022-08-12 18:13 1.1M 
[SND]0.mp32022-08-12 18:13 524K 
[SND]Things.mp32022-08-12 18:13 4.3M 
[SND]Tsinelas.mp32022-08-12 18:12 3.0M 
[SND]Sweater.mp32022-08-12 18:12 4.3M 
[SND]Stig.mp32022-08-12 18:12 4.8M 
[SND]Thankyou.mp32022-08-12 18:12 3.4M 
[SND]Theway.mp32022-08-12 18:12 2.8M 
[SND]TeleportMe.mp32022-08-12 18:11 2.7M 
[SND]Talk.mp32022-08-12 18:11 2.9M 
[SND]slowly.mp32022-08-12 18:11 2.7M 
[SND]Pogi.mp32022-08-12 18:11 4.1M 
[SND]Staywithme.mp32022-08-12 18:11 1.9M 
[SND]Peekaboo.mp32022-08-12 18:10 3.7M 
[SND]PSG.mp32022-08-12 18:10 2.8M 
[SND]Pahina.mp32022-08-12 18:10 5.2M 
[SND]perfect.mp32022-08-12 18:10 2.3M 
[SND]Own.mp32022-08-12 18:10 3.9M 
[SND]Norem.mp32022-08-12 18:09 4.2M 
[SND]Payday.mp32022-08-12 18:09 2.6M 
[SND]Orasna.mp32022-08-12 18:09 2.6M 
[SND]OneVoice.mp32022-08-12 18:09 2.5M 
[SND]Letme.mp32022-08-12 18:09 3.5M 
[SND]Loki.mp32022-08-12 18:09 2.9M 
[SND]Kontrabida.mp32022-08-12 18:09 5.1M 
[SND]Night.mp32022-08-12 18:08 2.8M 
[SND]Nasasanay.mp32022-08-12 18:08 5.3M 
[SND]big-baby-tape-kari.mp32022-08-12 18:08 0  
[SND]Me.mp32022-08-12 18:08 3.9M 
[SND]big-baby-tape-kizaru-99-problems.mp32022-08-12 18:08 0  
[SND]jamik-samolet-mp3.mp32022-08-12 18:08 0  
[SND]marceline.mp32022-08-12 18:08 2.4M 
[SND]Kings.mp32022-08-12 18:08 2.5M 
[SND]Jamik_feat_ARCHI_Kupyury (1).mp32022-08-12 18:07 0  
[SND]TOBA2.mp32022-08-12 18:06 0  
[SND]big-baby-tape-kizaru-dirrt.mp32022-08-12 18:05 0  
[SND]omda1 (2).mp32022-08-12 18:03 0  
[SND]jnh.mp32022-08-12 18:01 0  
[SND]par.mp32022-08-12 17:59 0  
[SND]happy Birthday versi BT21🤗😂 #bt21🙏#hutri75.mp32022-08-12 17:59 4.0M 
[SND]gor.mp32022-08-12 17:56 0  
[SND]ABBA - Mamma Mia (Jason Kokkovas Pop Punk cover).mp32022-08-12 17:54 0  
[SND]DJ BBHC PYRAMID SLOWED VIRAL TIKTOK (1).mp32022-08-12 17:54 0  
[SND]Onda Cero Entrevista 12 de agosto.mp32022-08-12 17:52 2.9M 
[SND]taek.mp32022-08-12 17:50 233K 
[SND]g6.mp32022-08-12 17:47 3.9M 
[SND]เพลง.mp32022-08-12 17:41 0  
[SND]muli.mp3.mp32022-08-12 17:36 0  
[SND]RAY.mp32022-08-12 17:36 0  
[SND]Slava Marlow - Camry 3.5 (Right Version) ♂Gachi Remix♂ prod.Rat TV (ПЕРЕЗАЛИВ).mp32022-08-12 17:34 824K 
[SND]ROGDJ.mp32022-08-12 17:30 0  
[SND]vp2.mp32022-08-12 17:30 3.4M 
[SND]vp1.mp32022-08-12 17:30 4.9M 
[SND]Anime_de_Japan_Torn_Apart_Bleach_OST_S_5Fn103TaY_3cef74cf.mp32022-08-12 17:30 0  
[SND]tpast.mp3.mp32022-08-12 17:29 0  
[SND]svt.mp32022-08-12 17:29 0  
[SND]TOBA4.mp32022-08-12 17:29 3.1M 
[VID]yt1s.com - غير وحدي مدمر نبغي نسكر عليها نهدر.mp42022-08-12 17:28 0  
[SND]ROG105.mp32022-08-12 17:26 0  
[SND]Tun.mp32022-08-12 17:25 0  
[SND]3 Daqat - Abu Ft. Yousra ثلاث دقات - أبو و يسرا[Mpgun.com].mp32022-08-12 17:23 0  
[SND]wibuu.mp32022-08-12 17:22 0  
[SND]bilel laabidi - Sebt w lahad( rap tounsi ) الغناية الحدث 😂😂 [Mpgun.com].mp32022-08-12 17:21 0  
[SND]Last Child - DUKA (Official Lyric Video).mp32022-08-12 17:17 644K 
[SND]Z9.mp32022-08-12 17:17 4.0M 
[SND]face-yumorist-mp3.mp32022-08-12 17:15 0  
[SND]Techno Ibiza 12-08-202WTF2 10-44.mp32022-08-12 17:15 0  
[SND]Ungu1.mp32022-08-12 17:12 0  
[SND]luffy2.mp32022-08-12 17:11 0  
[SND]H2.mp32022-08-12 17:10 3.9M 
[SND]Galau duka.mp32022-08-12 17:10 0  
[SND]Dj4.mp32022-08-12 17:10 1.2M 
[SND]TOBA.mp32022-08-12 17:10 0  
[SND]luffy3.mp32022-08-12 17:09 0  
[SND]Why This Kolaveri Di Dhanush 320kbps.mp32022-08-12 17:07 0  
[SND]legoislandbuggy.mp32022-08-12 17:07 0  
[SND]Lagnalu 2.0 Dj Govinda GR.mp32022-08-12 17:04 0  
[SND]k4.mp32022-08-12 17:01 4.0M 
[SND]Payphone1.mp32022-08-12 16:58 2.4M 
[SND]Пицца - Фары.mp32022-08-12 16:56 0  
[SND]DAVA & Kara Kross - Бум шакалака.mp32022-08-12 16:54 0  
[SND]as3.mp32022-08-12 16:53 3.6M 
[SND]Swagging.mp32022-08-12 16:52 0  
[SND]Ghostface_Playa_-_Swaggin'_at_the_Partment(128k).mp32022-08-12 16:51 0  
[SND]Rave.mp32022-08-12 16:49 2.4M 
[SND]k2.mp32022-08-12 16:47 4.0M 
[SND]Baumwolle-Raffael-A-Speechelo.mp32022-08-12 16:42 0  
[SND]Baumwolle-Max-D-Murf.mp32022-08-12 16:39 0  
[SND]Cheb Mourad - Yahsarah Ki Kounti Tebghini يا حصراه مين كنتي تبغيني (Slowed Reverb)(MP3_128K).mp32022-08-12 16:39 0  
[SND]Baumwolle-Lukas-Talkia.mp32022-08-12 16:35 0  
[SND]badass.mp32022-08-12 16:33 0  
[SND]c1.mp32022-08-12 16:33 4.8M 
[SND]Monster Ending 2 Make it home.mp32022-08-12 16:28 0  
[SND]ytmp3free.cc_uvi-pozdrav-brate-youtubemp3free.org.mp32022-08-12 16:26 0  
[SND]MIDNIGHT.mp32022-08-12 16:24 0  
[SND]anto23.mp32022-08-12 16:24 1.3M 
[SND]Further West Presents The Blank Tapes Cherry Girl Live at Raven Sound Studio.mp32022-08-12 16:22 3.1M 
[SND]Dhije1.mp32022-08-12 16:18 0  
[SND]proemquen.mp32022-08-12 16:17 0  
[SND]แว้นฟอร์มช่าง- 90s Supply (official MV) (1).mp32022-08-12 16:12 0  
[SND]Lesha_Svik_Malinoviy.mp32022-08-12 16:11 1.1M 
[SND]2021 YEAR END MASHUP - SUSH & YOHAN (BEST 130+ SONGS OF 2021).mp32022-08-12 16:07 11M 
[SND]Ghostface.m4a2022-08-12 16:07 1.9M 
[SND]Let Me Down Slowly x Kabhi Jo Badal Barse (Mashup) Alec Benjamin, Arijit Singh oddKidd.mp32022-08-12 16:06 2.8M 
[SND]Petta - Marana Mass Official Video (Tamil) Rajinikanth Anirudh Ravichander.mp32022-08-12 16:06 3.2M 
[SND]wes.mp32022-08-12 16:03 4.2M 
[SND]Mugen Train Ost - Akaza vs Rengoku.mp32022-08-12 16:01 19M 
[SND]anhky.mp32022-08-12 16:01 3.7M 
[SND]Beeping.mp32022-08-12 16:01 0  
[SND]Playa7.mp32022-08-12 15:59 0  
[SND]Sick.mp32022-08-12 15:58 0  
[SND]Playaa.mp32022-08-12 15:58 0  
[SND]Playa.mp32022-08-12 15:58 0  
[SND]chay.mp32022-08-12 15:57 0  
[SND]DJ KU HAMIL DULUAN SUDAH 3 BULAN SOUND USAT PINT VIRAL FYP TIKTOK.mp32022-08-12 15:55 0  
[SND]Beach Bunny - Prom Queen (Official Video).mp32022-08-12 15:55 0  
[SND]pristine2.mp32022-08-12 15:51 0  
[SND]total.mp32022-08-12 15:51 37M 
[SND]Aunt.mp32022-08-12 15:49 0  
[SND]INDRI.mp32022-08-12 15:48 0  
[SND]cj1.mp32022-08-12 15:47 0  
[VID]tan2.mp42022-08-12 15:46 0  
[SND]Bruno.mp32022-08-12 15:46 3.9M 
[SND]Queen.mp32022-08-12 15:45 2.1M 
[SND]Am1.mp32022-08-12 15:44 0  
[SND]ejay2.mp32022-08-12 15:44 0  
[SND]memek.mp32022-08-12 15:43 0  
[SND]Sn.Mp.mp32022-08-12 15:42 0  
[SND]sino.mp32022-08-12 15:40 0  
[SND]requestsino.mp32022-08-12 15:39 0  
[SND]X2Download.com - Jake Hill - dying lately (Full Album) (128 kbps).mp32022-08-12 15:37 0  
[SND]the best Ukrainian songs - BUSHIDO ZHO - Водила чувствует мой вайб.mp32022-08-12 15:37 0  
[SND]UNIQUE.mp32022-08-12 15:37 0  
[SND]Nerve.mp32022-08-12 15:36 0  
[SND]Кореш feat. treepside - Толпа.mp32022-08-12 15:36 0  
[SND]pristine.mp32022-08-12 15:36 0  
[SND]Ytta.mp32022-08-12 15:35 0  
[SND]Beep.mp32022-08-12 15:35 0  
[SND]kavabanga Depo kolibri - Рассвело.mp32022-08-12 15:34 0  
[SND]Kolaveri D-Cypher -- (Sush _ Yohan Mashup)(MP3_128K).mp32022-08-12 15:32 0  
[SND]miku.mp32022-08-12 15:32 0  
[SND]sheesh.m4a2022-08-12 15:32 0  
[SND]Fnatylqrd - Fed up..mp32022-08-12 15:30 0  
[SND]BANGSAD.mp32022-08-12 15:22 1.9M 
[SND]crush.mp32022-08-12 15:22 3.3M 
[SND]Jake_Hill_-_Stay_(Prod._CXDY)(256k).mp32022-08-12 15:19 0  
[SND]LAKEY INSPIRED - Chill Day.mp32022-08-12 15:17 0  
[SND]SAD.mp32022-08-12 15:15 0  
[SND]SBS.mp32022-08-12 15:14 0  
[SND]jo92.mp32022-08-12 15:13 0  
[SND]Narzzpro5.mp32022-08-12 15:09 0  
[SND]Jake Hill - nerve (Lyrics).mp32022-08-12 15:07 2.7M 
[SND]law.mp32022-08-12 15:07 0  
[SND]MARNIK x Alfons x Pule - Harry Potter Style (Lyrics Video).mp32022-08-12 15:06 0  
[SND]Sino.mp32022-08-12 15:04 0  
[SND]Dandelions_-_Ruth_B_(Lyrics_+_Slow_Version)(256k).mp32022-08-12 15:04 0  
[SND]Kendrick Lamar.mp32022-08-12 15:03 0  
[SND]trees.mp32022-08-12 15:03 0  
[SND]alan.mp32022-08-12 15:02 0  
[SND]zaebispizdato.mp32022-08-12 15:02 0  
[SND]Jake Hill - Follow Me Into Hell (EP).mp32022-08-12 15:02 0  
[SND]Jake Hill - Hiding in the Dark.mp32022-08-12 15:00 0  
[SND]fdsfsdf.mp32022-08-12 15:00 0  
[SND]1636722837_imagine-dragons-enemy-from-the-series-arcane-league-of-legends.mp32022-08-12 14:59 0  
[SND]y.mp32022-08-12 14:58 104K 
[SND]Anrufbeantworter einer Irrenanstalt.mp32022-08-12 14:57 0  
[SND]Tik.mp32022-08-12 14:57 0  
[SND]yon.mp32022-08-12 14:57 0  
[SND]shadowraze_-_showdown_73909739.mp32022-08-12 14:56 4.7M 
[SND]unnv-muza-mp3.mp32022-08-12 14:56 0  
[SND]iLOVEFRiDAY-Mia-Khalifa.mp32022-08-12 14:55 804K 
[SND]sed.mp32022-08-12 14:54 950K 
[SND]Dj Mbon.mp32022-08-12 14:52 0  
[SND]Lin.mp32022-08-12 14:52 0  
[SND]Sickomode.mp32022-08-12 14:52 1.2M 
[SND]tom.mp32022-08-12 14:51 1.6M 
[SND]
 - ⲋⲉⲭ ʀⲉⲙⲓⲭ _️ (1).mp32022-08-12 14:50 0  
[SND]
 - ⲋⲉⲭ ʀⲉⲙⲓⲭ _️ (1) (1).mp32022-08-12 14:50 0  
[SND]
 - Missчик.`.mp32022-08-12 14:50 0  
[SND]#Ắί₭Ǿ♫ - Дежавю.mp32022-08-12 14:50 0  
[SND]
 - cексуально. `_.mp32022-08-12 14:50 0  
[SND]
 - 86868.`__.mp32022-08-12 14:50 0  
[SND]
 - Ба ба ба._`.mp32022-08-12 14:50 0  
[SND]
 - _.`.mp32022-08-12 14:50 0  
[SND]- ⲋⲉⲭ ʀⲉⲙⲓⲭ 🕊️.mp32022-08-12 14:50 0  
[SND]
 - cause you are.` _.mp32022-08-12 14:50 0  
[SND]- у меня в планах забрать тебя.`.mp32022-08-12 14:50 3.4M 
[SND]sdhbet.mp32022-08-12 14:47 0  
[SND]Bf.mp32022-08-12 14:46 0  
[SND]hatt.mp32022-08-12 14:45 0  
[SND]- - Corvette' (slow).mp32022-08-12 14:45 0  
[SND]BASS CLUB (автозвук) - Громкий фронт 323.mp32022-08-12 14:45 0  
[SND](29)Migos - Racks 2 Skinny(Screwed By Artem).mp32022-08-12 14:44 0  
[SND]Growna.mp3.mp32022-08-12 14:43 1.5M 
[SND]bubble.mp32022-08-12 14:41 0  
[SND]Lena_Raine_-_Pigstep_Minecraft_OST_69258249.mp32022-08-12 14:33 0  
[SND]Growna1.mp32022-08-12 14:28 0  
[SND]fukiangga.mp32022-08-12 14:28 0  
[SND]anggakul.mp32022-08-12 14:27 0  
[SND]Teger.mp32022-08-12 14:24 0  
[SND]b128453d3e6881d692e2ca81d1d3c94d.mp32022-08-12 14:24 0  
[SND]loginmusic.mp32022-08-12 14:22 0  
[SND]GR 1.MP3.mp32022-08-12 14:22 0  
[SND]link.mp32022-08-12 14:21 3.4M 
[SND]twerk.mp32022-08-12 14:17 0  
[SND]mmmm.mp32022-08-12 14:17 0  
[SND]djmerahh.mp32022-08-12 14:16 0  
[SND]luffy.mp32022-08-12 14:14 3.0M 
[SND]Chekele(PagalWorld).mp32022-08-12 14:13 0  
[SND]beast.mp32022-08-12 14:13 2.6M 
[SND]Maid Dress GR.mp32022-08-12 14:13 0  
[SND]vortex1.mp32022-08-12 14:10 324K 
[SND]Z6.mp32022-08-12 14:06 3.6M 
[SND]Z1.mp32022-08-12 14:06 0  
[SND]tyes.mp32022-08-12 14:05 248K 
[SND]Z5.mp32022-08-12 14:05 4.8M 
[SND]Z4.mp32022-08-12 14:05 3.6M 
[SND]Sannztuy.mp32022-08-12 14:05 1.7M 
[SND]Z3.mp32022-08-12 14:05 2.4M 
[SND]Z2.mp32022-08-12 14:05 4.1M 
[SND]ASIKINbre.mp32022-08-12 14:02 0  
[SND]anton.mp32022-08-12 14:02 344K 
[SND]applee.mp32022-08-12 14:02 0  
[SND]Kesariya.mp32022-08-12 14:01 0  
[SND]Bruno_Mars_-_It_Will_Rain_(Official_Music_Video)(128k).mp32022-08-12 14:00 0  
[SND]Dhijehh.mp32022-08-12 13:59 0  
[SND]thanhak.mp32022-08-12 13:58 0  
[SND]regge.mp32022-08-12 13:58 0  
[SND]santuybngst.mp32022-08-12 13:57 0  
[SND]Ravicks1.mp32022-08-12 13:56 0  
[SND]chifu.mp32022-08-12 13:55 0  
[SND]Ska.mp32022-08-12 13:54 0  
[SND]Ze4.mp32022-08-12 13:54 0  
[SND]Ze6.mp32022-08-12 13:54 0  
[SND]Ze5.mp32022-08-12 13:54 0  
[SND]Ze2.mp32022-08-12 13:53 0  
[SND]KAMPANGGG.mp32022-08-12 13:53 0  
[SND]ZE1.mp32022-08-12 13:53 0  
[SND]ASUI.mp32022-08-12 13:51 0  
[SND]p3.mp32022-08-12 13:46 0  
[SND]Jin_Dogg_街風_feat_REAL_T_Official_Music_Vi.mp32022-08-12 13:44 0  
[SND]gta.mp32022-08-12 13:43 136K 
[SND]astrea redux - timemachine [audiovk.com].mp32022-08-12 13:43 0  
[SND]A8.mp32022-08-12 13:42 0  
[SND]marcin_przybyowicz_-_a_story_you_wont_believe_(z2.fm).mp32022-08-12 13:39 0  
[SND]PANTEK.mp32022-08-12 13:38 0  
[VID]25145f62246bde9491eca32dde3e42dc.mp42022-08-12 13:37 0  
[SND]Caham.mp32022-08-12 13:36 0  
[SND]dj13.mp32022-08-12 13:36 0  
[SND]ASUII.mp32022-08-12 13:35 0  
[SND]andrewsad.mp32022-08-12 13:28 0  
[SND]toto.mp32022-08-12 13:26 3.0M 
[SND]X2Download.com - Versi koplo Viral TikTok Okey Are you Ready lagu Thailand wong e e e e e wong e e e e e (128 kbps).mp32022-08-12 13:26 3.7M 
[SND]za3im.mp32022-08-12 13:25 2.9M 
[SND]Geoxor_-_Aurora_(Byfet.com).mp32022-08-12 13:24 0  
[SND]Y0VNG ZXR0 - Yandere ft. Ambi (Prod. Bughvvl)-1.mp32022-08-12 13:24 0  
[SND]Dj dermaga biru.mp32022-08-12 13:23 0  
[SND]YUNG-RARE _ KXLLSWXTCH ☢️ - TALIBAN DEADBEATVILLAIN.mp32022-08-12 13:23 0  
[SND]Lyova_Vlax_-_A_edet_katitsya_zanijena_priora.mp32022-08-12 13:22 0  
[SND]musik.mp32022-08-12 13:21 0  
[SND]Pop Smoke - Get Back (mp3store.cc).mp32022-08-12 13:21 0  
[SND]Skirii1.mp32022-08-12 13:18 0  
[SND]vortex.mp32022-08-12 13:17 0  
[SND]GeorgeM1.mp32022-08-12 13:17 0  
[SND]Vp9.mp32022-08-12 13:15 116K 
[SND]POROJO.mp32022-08-12 13:14 0  
[SND]Galauu18.mp32022-08-12 13:14 0  
[SND]Dennz.mp32022-08-12 13:13 0  
[SND]DAY DAY.mp32022-08-12 13:13 0  
[SND]Pop Smoke - Get Back.mp32022-08-12 13:09 0  
[SND]$uicideboy$ - Fuck Boy Blood Bath.mp32022-08-12 13:06 0  
[SND]Chinx (OS) - Secrets Not Safe.mp32022-08-12 13:05 0  
[SND]6.mp32022-08-12 13:05 40K 
[SND]Ssinar.mp32022-08-12 13:02 0  
[SND]intheend.mp32022-08-12 13:01 0  
[SND]Sinar.mp32022-08-12 13:01 0  
[SND]DJ GODZILLA V2 SLOW REMIX viral FYP tiktok 2022🎶🎧.mp32022-08-12 12:59 0  
[SND]bodiev-kruzak-200-remix.mp32022-08-12 12:58 0  
[SND]Beach Bunny - Prom Queen (Speed Up) lyrics 🎶.mp32022-08-12 12:56 0  
[SND]1..mp32022-08-12 12:56 0  
[SND]psovsk.mp32022-08-12 12:55 0  
[SND]DJ CLOSE YOUR EYE x BANGUN TIDUR SELFIE x GO SAMPE BAWAH VIRAL TIK TOK TERBARU 2022!!.mp32022-08-12 12:55 3.5M 
[SND]3.mp32022-08-12 12:54 2.1M 
[SND]2.mp32022-08-12 12:53 276K 
[SND]Kandas15.mp32022-08-12 12:51 0  
[SND]ai_papai.mp32022-08-12 12:50 0  
[SND]Pesnya_Moj_drug_ms_bombil_tolko_legalno.mp32022-08-12 12:49 0  
[SND]Thinkdi.mp32022-08-12 12:46 0  
[SND]Shincan.mp32022-08-12 12:46 0  
[SND]until faond.mp32022-08-12 12:45 0  
[SND]oky.mp32022-08-12 12:38 0  
[SND]dan.mp32022-08-12 12:34 0  
[SND]kane.mp32022-08-12 12:33 2.8M 
[SND]akankah.mp32022-08-12 12:32 0  
[SND]y2mate.com - Romantic Happy Birthday Arranged by Miranda Wong Piano Cover.mp32022-08-12 12:30 0  
[SND]Vladimir Shaikin (_Blacksmith_) — It's Showtime! (Elias' Theme) (www.lightaudio.ru).mp32022-08-12 12:27 0  
[SND]A_cyplenok_pi-pi-piu_-_A_u_nas_zhivet_cyplenok_(iPleer.com).mp32022-08-12 12:26 0  
[SND]m23.mp32022-08-12 12:25 2.1M 
[SND]Ghostemane - Bonesaw.mp32022-08-12 12:23 0  
[SND]vikram.mp32022-08-12 12:22 2.3M 
[SND]iop.mp32022-08-12 12:22 0  
[SND]kal.mp32022-08-12 12:19 0  
[SND]zxc.mp32022-08-12 12:17 728K 
[SND]omda2.mp32022-08-12 12:15 628K 
[SND]fivem.mp32022-08-12 12:13 92K 
[SND]Vp4.mp32022-08-12 12:10 2.2M 
[SND]V-$-XV-PRiNCE_De_Lacure-Jyrigimdi.mp32022-08-12 12:02 1.3M 
[SND]memay.mp32022-08-12 12:01 0  
[SND]Dhikaa9.MP.mp32022-08-12 12:01 0  
[SND]DhikaSad8.MP.mp32022-08-12 12:01 0  
[SND]Dhikaa8.mp32022-08-12 12:01 0  
[SND]Dhikaa3.mp32022-08-12 12:00 0  
[SND]Dhikaa2.mp32022-08-12 12:00 4.0M 
[SND]Dhikaa5.mp32022-08-12 12:00 0  
[SND]Dhikaa7.mp32022-08-12 12:00 0  
[SND]god.mp32022-08-12 11:59 16K 
[SND]V $ X V PRiNCE, De Lacure - Жүрегімді.mp32022-08-12 11:57 0  
[SND]BO.mp32022-08-12 11:57 0  
[SND]Bakr_-_Status_dushi_73037819.mp32022-08-12 11:53 6.9M 
[SND]KO.mp32022-08-12 11:53 1.1M 
[SND]Mahika.mp3.mp32022-08-12 11:50 2.5M 
[SND]MO.mp32022-08-12 11:50 4.6M 
[SND]sex.mp32022-08-12 11:49 1.8M 
[SND]TVアニメ『サクラクエスト』ノンクレジットOP/「Morning Glory」(K)NoW_NAME.mp32022-08-12 11:48 0  
[SND]omda3.mp32022-08-12 11:43 1.7M 
[SND]KIRYa_NASVAEV_Matiz.mp32022-08-12 11:42 1.1M 
[SND]loveuna.mp32022-08-12 11:41 0  
[SND]y2mate.com - Rizkyfebian Selamat Ulang tahun Lyrics.mp32022-08-12 11:36 0  
[SND]odium.mp32022-08-12 11:36 0  
[SND]km.mp32022-08-12 11:35 2.4M 
[SND]lop.mp32022-08-12 11:34 0  
[SND]______.mp32022-08-12 11:31 0  
[SND]Pik - Güzelsin (Turkish Trap)333.mp32022-08-12 11:30 0  
[SND]Shincandj.mp32022-08-12 11:30 0  
[SND]empire.mp32022-08-12 11:29 0  
[SND]Dr.Fresch_ Mina Knock _-_ Feedback_ -_ Feedback1.mp32022-08-12 11:26 0  
[SND]FreigrabeImpuls (DJ Cannabis Coffeeshops Deutschland).mp32022-08-12 11:25 0  
[SND]Kopikap2.mp32022-08-12 11:23 0  
[SND]Dhije.mp32022-08-12 11:18 3.3M 
[SND]Thinkdick.mp32022-08-12 11:18 0  
[SND]GREEY5.mp32022-08-12 11:17 0  
[SND]GREEY6.mp32022-08-12 11:17 0  
[SND]GREEY3.mp32022-08-12 11:17 0  
[SND]GREEY4.mp32022-08-12 11:17 0  
[SND]GREEY2.mp32022-08-12 11:17 0  
[SND]GREEY1.mp32022-08-12 11:16 0  
[SND]shesgone .mp32022-08-12 11:16 0  
[SND]Dj sikok bagi duo.mp32022-08-12 11:15 0  
[SND]Old Love - Yuji _ Putri Dahlia.mp32022-08-12 11:13 0  
[SND]A.mp32022-08-12 11:12 0  
[SND]dingdut1.mp32022-08-12 11:11 0  
[SND]DhikaSad (1).mp32022-08-12 11:05 1.2M 
[SND]ilham11.mp32022-08-12 11:03 1.9M 
[SND]wtf.mp32022-08-12 11:03 1.6M 
[SND]Смешарики - От Винта (Bass Boosted By Лампочка 30db) (mp3-2020.com).mp32022-08-12 11:02 0  
[SND]Myz1.mp32022-08-12 10:58 0  
[SND]selebew.mp32022-08-12 10:57 0  
[SND]Zexx1.mp32022-08-12 10:54 0  
[SND]M.I.B - Jak (Official MV).mp32022-08-12 10:54 0  
[SND]Marshi I UÇK (Albanian War Song).mp32022-08-12 10:48 0  
[SND]omda1.mp32022-08-12 10:47 0  
[SND]instasamka-moneyken-love-speed-up.mp32022-08-12 10:45 0  
[SND]King of Doowhite - Maiyarap ft.Repaze [Official MV].mp32022-08-12 10:44 0  
[SND]sova-pesni-staryh-kasset.mp32022-08-12 10:42 0  
[SND]chillbuon1199.mp32022-08-12 10:41 0  
[SND]VY.mp32022-08-12 10:39 0  
[SND]Баллада о забытом мире.mp32022-08-12 10:39 212K 
[SND]white_NH4XfTU.mp32022-08-12 10:37 0  
[SND]not-for-sale-fossil-kanon-wakeshima-4786337666483773616-dgtx5sbw_0whlYJAI.mp32022-08-12 10:36 0  
[SND]not-for-sale-fossil-kanon-wakeshima-4786337666483773616-dgtx5sbw_0Njc72gq.mp32022-08-12 10:35 0  
[SND]nhacthattinh1129.mp32022-08-12 10:35 0  
[SND]ajimat.mp32022-08-12 10:35 916K 
[SND]chpunk-edison-ochko.mp32022-08-12 10:35 0  
[SND]belat1109.mp32022-08-12 10:35 0  
[SND]not-for-sale-fossil-kanon-wakeshima-4786337666483773616_DGtX5sbw.mp32022-08-12 10:27 0  
[SND]pesnya-ya-mazhu-vazelinom.mp32022-08-12 10:21 0  
[SND]dajte-tank-besy_(mp3IQ.net).mp32022-08-12 10:18 0  
[SND]alpin.mp32022-08-12 10:16 0  
[SND]k111.mp32022-08-12 10:15 0  
[SND]They.mp32022-08-12 10:13 0  
[SND]Аквариум - 212-85-06 (OST ПитерFM).mp32022-08-12 10:11 6.5M 
[SND]Dajjte_tank_-_Besy_(musmore.com).mp32022-08-12 10:11 0  
[SND]zxcursedkillua.mp3.mp32022-08-12 10:10 0  
[SND]s99.mp32022-08-12 10:10 0  
[SND]darr1.mp32022-08-12 10:09 0  
[SND]rexx.mp32022-08-12 10:09 0  
[SND]zxcursedKillua (2).mp32022-08-12 10:06 0  
[SND]zxcursedkillua.mp32022-08-12 10:05 0  
[SND]dar1.mp32022-08-12 10:04 0  
[SND]audiomsg_641244583.mp32022-08-12 10:04 0  
[SND]imagelinefixyourshittyprogram.mp32022-08-12 10:03 0  
[SND]DANY8081.mp32022-08-12 10:00 0  
[SND]darar1.mp32022-08-12 10:00 0  
[SND]The.mp32022-08-12 09:59 104K 
[SND]Falmengkane11.mp32022-08-12 09:59 0  
[SND]yahah.mp32022-08-12 09:55 0  
[SND]CALLME.mp32022-08-12 09:53 0  
[SND]The Yes Yes Show - Francis M & Parokya Ni Edgar.mp32022-08-12 09:52 0  
[SND]y2mate.com - DJ KANDAS DANGDUT DJ KANDAS JEDAG JEDUG SLOW FULL BASS VIRAL FYP TIK TOK 2022.mp32022-08-12 09:51 0  
[SND]GREYGODS[ConverteZilla.com].mp32022-08-12 09:51 0  
[SND]zxcursed_Killua.mp32022-08-12 09:51 0  
[SND]sunroof.mp32022-08-12 09:50 2.7M 
[SND]k6.mp32022-08-12 09:49 1.9M 
[SND]k5.mp32022-08-12 09:48 7.7M 
[SND]zxcursed_-_killua_74293338.mp32022-08-12 09:45 0  
[SND]GARUDA.mp32022-08-12 09:43 0  
[SND]Klava_Bravo_Nazyvaj_menya_trener_remiks.mp32022-08-12 09:42 2.1M 
[SND]k3.mp32022-08-12 09:41 3.1M 
[SND]fridaynight.mp32022-08-12 09:38 3.2M 
[SND]Djenak.mp32022-08-12 09:36 4.0M 
[SND]Oliver_Tree_-_Jerk_70287833.mp32022-08-12 09:34 2.3M 
[SND]XD5.mp32022-08-12 09:33 0  
[SND]shadowraze_-_Shadow_Fiend_73331416.mp32022-08-12 09:33 0  
[SND]shadowfiend_feat_perfect_player_-_shadowraze_71630335.mp32022-08-12 09:33 0  
[SND]joy100.mp32022-08-12 09:32 0  
[SND]XD4.mp32022-08-12 09:30 0  
[SND]shadowraze_-_juggernaut_Prod_by_PLVSTIC_Prod_by_PLVSTIC_73220345.mp32022-08-12 09:26 0  
[SND]rakhim_20_-_21.mp32022-08-12 09:26 0  
[SND]Shadowraze_babyswishh1_-_psiblades_73220334 (1).mp32022-08-12 09:26 0  
[SND]ebanko-lyubitel-sobak-ya-ebu-sobak.mp32022-08-12 09:25 5.1M 
[SND]XD3.mp32022-08-12 09:24 0  
[SND]XD2.mp32022-08-12 09:24 0  
[SND]XD6.mp32022-08-12 09:24 0  
[SND]rakhim_20-21.mp32022-08-12 09:24 0  
[SND]zxcursed_-_never_enough_74046259.mp32022-08-12 09:24 0  
[SND]XD1.mp32022-08-12 09:21 0  
[SND]nelsen.mp32022-08-12 09:14 0  
[SND]rakhim_20-20.mp32022-08-12 09:06 5.2M 
[SND]mikedingin.mp32022-08-12 09:03 4.5M 
[SND]BAKAR.mp32022-08-12 09:03 4.2M 
[SND]ER.mp32022-08-12 09:02 3.6M 
[SND]rakhim_20_20.mp32022-08-12 09:01 0  
[SND]mike2.mp32022-08-12 08:57 0  
[SND]xvx.mp32022-08-12 08:54 0  
[SND]sepka.mp32022-08-12 08:47 0  
[SND]shen.mp32022-08-12 08:45 0  
[SND]Dhije4.mp32022-08-12 08:45 3.3M 
[SND]xa.mp32022-08-12 08:44 3.8M 
[SND]tothebone.mp32022-08-12 08:42 2.0M 
[SND]beautyandbeat.mp32022-08-12 08:38 0  
[SND]Xybca5.mp32022-08-12 08:37 0  
[SND]Sektor_Gaza_-_Kolkhoznyjj_pank_48646528.mp32022-08-12 08:33 0  
[SND]cigar.mp32022-08-12 08:30 0  
[SND]Sergejj_Zavyalov_-_Ty_dlya_menya_odna_62331592.mp32022-08-12 08:30 0  
[SND]tiktod.mp32022-08-12 08:28 0  
[SND]BOJO.mp32022-08-12 08:21 0  
[SND]ANJ.mp32022-08-12 08:20 0  
[SND]SOUND JJ ZERSOFBOY.mp32022-08-12 08:19 0  
[SND]anditox.mp32022-08-12 08:17 0  
[SND]vv.mp32022-08-12 08:16 200K 
[SND]Cardi_B_Megan_Thee_Stallion_-_WAP_70519836.mp32022-08-12 08:16 0  
[SND]BOBOLE.mp32022-08-12 08:16 0  
[SND]casablanca.mp32022-08-12 08:15 256K 
[SND]luce4.mp32022-08-12 08:14 0  
[SND]gehoy.mp32022-08-12 08:11 0  
[SND]ww.mp32022-08-12 08:11 2.8M 
[SND]ayana.mp32022-08-12 08:09 0  
[SND]comeonradio.mp32022-08-12 08:07 0  
[SND]SnapTik_7051841172783910170.mp32022-08-12 08:06 0  
[SND]Mobb Deep - Shook Ones, Pt. II (Official HD Video).mp32022-08-12 08:05 0  
[SND]ComeInside3.mp32022-08-12 08:03 0  
[SND]OOR3.mp32022-08-12 08:02 1.8M 
[SND]Decade1.mp32022-08-12 07:58 0  
[SND]DJBABA.mp32022-08-12 07:57 0  
[SND]A05.mp32022-08-12 07:56 0  
[SND]A04.mp32022-08-12 07:56 0  
[SND]A03.mp32022-08-12 07:55 0  
[SND]A02.mp32022-08-12 07:55 0  
[SND]A01.mp32022-08-12 07:55 0  
[SND]Yang Peng - Long Night Journey.mp32022-08-12 07:55 0  
[SND]Just Friends - Pee Wee Gaskins Instrument (minus one karoke version, no vocal) lyric.mp32022-08-12 07:54 0  
[SND]OOR2.mp32022-08-12 07:53 0  
[SND]Vp12.mp32022-08-12 07:49 3.5M 
[SND]Vp11.mp32022-08-12 07:49 3.7M 
[SND]Aarne feat. Big Baby Tape - Ski Ski (2).mp32022-08-12 07:46 0  
[SND]RdP12.mp32022-08-12 07:44 0  
[SND]TULUS-Monokrom-Official-Music-Video_QqJ-Vp8mvbk.mp32022-08-12 07:43 0  
[SND]Decade9.mp32022-08-12 07:40 0  
[SND]fivem3.mp32022-08-12 07:36 0  
[SND]OOR1.mp32022-08-12 07:36 0  
[SND]Sugaldo Ganteng.mp32022-08-12 07:36 0  
[SND]luce2.mp32022-08-12 07:33 0  
[SND]on.mp32022-08-12 07:32 2.4M 
[SND]ALX.mp32022-08-12 07:27 0  
[SND]Zv1.mp32022-08-12 07:26 0  
[SND]bp-du2.mp32022-08-12 07:25 0  
[SND]bp-du.mp32022-08-12 07:22 0  
[SND]shadowraze.mp32022-08-12 07:22 4.6M 
[SND]rc.mp32022-08-12 07:17 0  
[SND]Modern Talking — Cheri Cheri Lady.mp32022-08-12 07:17 0  
[SND]Мурат Тхагалегов - За тебя Калым отдам.mp32022-08-12 07:17 208K 
[SND]Binibirocha.mp32022-08-12 07:14 3.2M 
[SND]INSTASAMKA – MONEYKEN LOVE prod realmoneyken.mp32022-08-12 07:13 0  
[SND]RV.mp32022-08-12 07:10 0  
[SND]rv-fmr1.mp32022-08-12 07:06 0  
[SND]MESSII.mp32022-08-12 07:03 0  
[SND]rv-fmr.mp32022-08-12 06:58 0  
[SND]dr-dre-deep-cover-feat-snoop-dogg.mp32022-08-12 06:55 9.8M 
[VID]Tan2.mp42022-08-12 06:55 0  
[SND]Freddie Dredd - All Alone.mp32022-08-12 06:55 0  
[SND]snoop-dogg-dr-dre-deep-cover-uncensored.mp32022-08-12 06:54 0  
[SND]Dr. Dre - Deep Cover (feat. Snoop Dogg) (mp3store.cc).mp32022-08-12 06:53 0  
[SND]instasamka-moya-kiska-dlya-nego-vsegda-gotova.mp32022-08-12 06:53 0  
[SND]Psych - 9 Мая [Рэп-Столица]_(tiktok-pesni.com).mp32022-08-12 06:50 0  
[VID]tan.mp42022-08-12 06:47 408K 
[SND]aespa-lts.mp32022-08-12 06:45 2.9M 
[SND]BORNEO.mp32022-08-12 06:43 8.0M 
[SND]ikmal.mp32022-08-12 06:39 278K 
[SND]hejoboys.mp32022-08-12 06:36 0  
[SND]N3.mp32022-08-12 06:35 0  
[SND]N2.mp32022-08-12 06:34 0  
[SND]akamsi.mp32022-08-12 06:32 0  
[SND]N1.mp32022-08-12 06:32 0  
[SND]あれくん Alekun「ずるいよ、、、」Zurui yo _Lyrics.mp32022-08-12 06:24 0  
[SND]#Lyric WEST MELANESIA.mp32022-08-12 06:23 0  
[SND]y2mate.com - GUYONWATON OFFICIAL SEBATAS TEMAN OFFICIAL LYRIC VIDEO.mp32022-08-12 06:23 0  
[SND]sound.mp32022-08-12 06:21 0  
[SND]jah-khalib-guf-na-svoyom-vajbe-mp3.mp32022-08-12 06:18 0  
[SND]Jah Khalib _ Guf - На Своём Vibe.mp32022-08-12 06:17 0  
[SND]Mario Zwinkle X Keilandboi - Heavy In The Game INSTRUMENTAL.mp32022-08-12 06:17 0  
[SND]Пошлая Молли - Нон стоп.mp32022-08-12 06:16 0  
[SND]bagiduo.mp32022-08-12 06:07 4.3M 
[SND]gtw.mp32022-08-12 05:58 0  
[SND]Dj.mp32022-08-12 05:56 0  
[SND]nicaplaylist.mp32022-08-12 05:52 0  
[SND]mabukcinta.mp32022-08-12 05:50 0  
[SND]SANS.mp32022-08-12 05:50 0  
[SND]Ezra7.mp32022-08-12 05:49 0  
[SND]SKIN.mp32022-08-12 05:48 0  
[SND]LL.mp32022-08-12 05:46 2.8M 
[SND]Wolve.mp32022-08-12 05:46 0  
[SND]Честный - Мама.mp32022-08-12 05:45 0  
[SND]Glooco2.mp32022-08-12 05:42 1.6M 
[SND]Glooco1.mp32022-08-12 05:41 467K 
[SND]mp15.mp32022-08-12 05:41 3.6M 
[SND]DhikaSad.mp32022-08-12 05:40 0  
[SND]mp14.mp32022-08-12 05:38 268K 
[SND]DEYO.mp32022-08-12 05:38 184K 
[SND]kkk.mp32022-08-12 05:37 2.2M 
[SND]plume.mp32022-08-12 05:36 0  
[SND]XNCX.mp32022-08-12 05:33 52K 
[SND]mp13.mp32022-08-12 05:32 4.2M 
[SND]aaa.mp32022-08-12 05:29 2.0M 
[SND]plenka_-_Call_Me_(Slowed).mp32022-08-12 05:28 6.2M 
[SND]prodby668_-_prolly_my_spookiest_beat_sped_up_73964471.mp32022-08-12 05:27 0  
[SND]Lemon_Demon_-_Touch-Tone_Telephone_69649037.mp32022-08-12 05:26 0  
[SND]WESTLBRTY'S - SAN-FIERRO.mp32022-08-12 05:26 0  
[SND]sss.mp32022-08-12 05:18 3.0M 
[SND]friendcity1.mp32022-08-12 05:18 0  
[SND]pasoori.mp32022-08-12 05:15 3.6M 
[SND]friends1.mp32022-08-12 05:15 0  
[SND]friends2.mp32022-08-12 05:14 0  
[SND]Norin.mp32022-08-12 05:14 880K 
[SND]friend1.mp32022-08-12 05:11 0  
[SND]frend1.mp32022-08-12 05:09 0  
[SND]da.mp32022-08-12 05:07 3.1M 
[SND]aku selalu bahagia.mp32022-08-12 05:06 0  
[SND]หูไม่ตรงกับตา.mp32022-08-12 05:06 0  
[SND]WE_NEVER_DIE_-_BROKER_NEIRP_ANTHEM_OFFICIAL_AUDIO_(Prod.By_Rifky_Arizaldy)(128k).mp32022-08-12 05:04 3.0M 
[SND]ck.mp32022-08-12 05:01 0  
[SND]friend-1.mp32022-08-12 05:01 0  
[SND]4WHEEL_-_KERAUNOS_KILLER_73336472.mp32022-08-12 05:01 0  
[SND]กำลังฮิตในTikTok ( เอวติดไฟ -Bear Knuckle) V.แดนซ์ยกเบสหนัก ๆๆ Pao Remix.mp32022-08-12 05:00 0  
[SND]Psyco M - Plume-Psyco-M.mp32022-08-12 04:44 0  
[SND]Party.mp32022-08-12 04:35 0  
[SND]Journey_-_Separate_Ways_Worlds_Apa_(getmp3.pro).mp32022-08-12 04:31 0  
[SND]Endank.mp32022-08-12 04:27 0  
[SND]Bungul3.mp32022-08-12 04:27 0  
[SND]Bungul4.mp32022-08-12 04:27 0  
[SND]who.mp32022-08-12 04:22 0  
[SND]bck.mp32022-08-12 04:22 0  
[SND]CL.mp32022-08-12 04:17 0  
[SND]milisikecoa.mp32022-08-12 04:12 0  
[SND]PERFECTCHRISTMAS.mp32022-08-12 04:04 0  
[SND]nhelongvlc.mp32022-08-12 03:57 2.5M 
[SND]tklove.mp32022-08-12 03:33 0  
[SND]徐佳莹&阿爆&Brandy-切歌 feat. ABAO阿爆&Brandy.mp32022-08-12 03:32 0  
[SND]Azari_-_Nightmare_(musmore.com).mp32022-08-12 03:28 0  
[SND]hot60.mp32022-08-12 03:20 0  
[SND]y2mate.com - DJ TELOLET X RINDU SEMALAM SLOW Viral Di Fyp TikTok.mp32022-08-12 03:20 0  
[SND]rap100.mp32022-08-12 03:14 0  
[SND]p2.mp32022-08-12 03:10 536K 
[SND]bangbang.mp32022-08-12 03:06 0  
[SND](26,29,35,40hz)Need for Speed - Get Low(Screwed by Gorilla_Bass).mp32022-08-12 03:04 0  
[SND]Dissah Dzu - Uatnek 21.mp32022-08-12 02:58 0  
[SND]BODIEV - Между девятин.mp32022-08-12 02:58 0  
[SND]77-й'. - .mp32022-08-12 02:58 0  
[SND]1-❤ - качает`.mp32022-08-12 02:58 2.0M 
[SND]p1.mp32022-08-12 02:47 214K 
[SND]Ben3.mp32022-08-12 02:36 0  
[SND]WestBarrio.mp32022-08-12 02:29 0  
[SND]Takbo.mp32022-08-12 02:29 0  
[SND]BCFL.mp32022-08-12 02:29 0  
[SND]RidinHigh.mp32022-08-12 02:29 0  
[SND]Pagmamahal.mp32022-08-12 02:28 0  
[SND]OneOfTheseDays.mp32022-08-12 02:28 0  
[SND]bang3.mp32022-08-12 02:24 0  
[SND]andika1.mp32022-08-12 02:09 0  
[SND]AjimatMG.mp32022-08-12 02:08 0  
[SND]hatepok1.mp32022-08-12 02:08 0  
[SND]SAY.mp32022-08-12 02:07 0  
[SND]How.mp32022-08-12 02:07 0  
[SND]NOTHING.mp32022-08-12 02:07 3.8M 
[SND]Never.mp32022-08-12 02:07 3.2M 
[SND]FOREVER.mp32022-08-12 02:07 0  
[SND]Thewill.mp32022-08-12 02:07 0  
[SND]EXCHANGE.mp32022-08-12 02:07 0  
[SND]KLM.mp32022-08-12 02:07 0  
[SND]andika1.m4a2022-08-12 02:02 0  
[SND]Jewish Princess.mp32022-08-12 02:00 0  
[SND]xwan39.mp32022-08-12 01:59 0  
[SND]xwan40.mp32022-08-12 01:58 0  
[SND]xwan41.mp32022-08-12 01:58 0  
[SND]Y2Mate.is - Round Change - Shadows of Evil - Soundtrack-OGYa9IrOf9s-160k-1660269164390.mp32022-08-12 01:54 0  
[SND]np6.mp32022-08-12 01:54 0  
[SND]np5.mp32022-08-12 01:54 0  
[SND]np4.mp32022-08-12 01:53 0  
[SND]np3.mp32022-08-12 01:53 0  
[SND]Pagsamo.mp32022-08-12 01:53 4.4M 
[SND]Say.mp32022-08-12 01:53 0  
[SND]Mapa.mp32022-08-12 01:53 2.2M 
[SND]NOBITA.mp32022-08-12 01:53 0  
[SND]the will.mp32022-08-12 01:53 0  
[SND]Binibini.mp32022-08-12 01:53 0  
[SND]np2.mp32022-08-12 01:53 0  
[SND]Exchange.mp32022-08-12 01:53 0  
[SND]np1.mp32022-08-12 01:53 0  
[SND]tarik1.mp32022-08-12 01:52 3.3M 
[SND]M.T.G - (Only Fans feat. No1-NOAH .mp32022-08-12 01:51 0  
[SND]Forevermore.mp32022-08-12 01:47 812K 
[SND]TheFinal.mp32022-08-12 01:42 0  
[SND]bv.mp32022-08-12 01:37 0  
[SND]Vendredi13Août2021.mp32022-08-12 01:26 0  
[SND]Dw1.mp32022-08-12 01:26 80K 
[SND]Dw3.mp32022-08-12 01:26 0  
[SND]Dw2.mp32022-08-12 01:26 0  
[SND]Dw5.mp32022-08-12 01:26 1.6M 
[SND]lagu1.mp32022-08-12 01:24 1.1M 
[SND]Afgan - Jodoh Pasti Bertemu Official Video Clip.mp32022-08-12 01:23 0  
[SND]On The Floor - Jennifer Lopez.mp32022-08-12 01:22 5.7M 
[SND]Kesariya (From Brahmastra) - Pritam.mp32022-08-12 01:22 4.1M 
[SND]Hookah Bar (LoFi) - Shubham Rangra.mp32022-08-12 01:22 4.4M 
[SND]Sodakku_From_Thaanaa_Serndha_Koottam_Anirudh_Ravichander.mp32022-08-12 01:22 3.7M 
[SND]Azhalinte_Azhangalil_From_Ayalum_Njanum_Thammil_Male_Vocals_Nikhil.mp32022-08-12 01:22 5.2M 
[SND]Kudukku - Vineeth Sreenivasan.mp32022-08-12 01:21 2.4M 
[SND]mn.mp32022-08-12 01:21 2.4M 
[SND]Project - 8:11:22, 5.59 PM.mp32022-08-12 01:20 0  
[SND]v4.mp32022-08-12 01:19 3.4M 
[SND]Vicks1.mp32022-08-12 01:18 1.3M 
[SND]v5.mp32022-08-12 01:15 388K 
[SND]Jejennie.mp32022-08-12 01:14 0  
[SND]vp7.mp32022-08-12 01:12 0  
[SND]mygang.mp32022-08-12 01:11 0  
[SND]1_4943094942051336640.mp32022-08-12 01:09 0  
[SND]Took Him Too - John Sebby Elliott Sheridan.mp32022-08-12 01:08 0  
[SND]matila.mp32022-08-12 01:06 0  
[SND]Razz1.mp32022-08-12 01:05 0  
[SND]phupu.mp32022-08-12 01:03 0  
[SND]7077114216255064859.mp32022-08-12 00:59 0  
[SND]N1NT3ND0_-_CHP_47965410.mp32022-08-12 00:55 0  
[SND]puresouls7.22.19.mp32022-08-12 00:50 0  
[SND]LILDRUGHILL_MARCO_9_Jet.mp32022-08-12 00:42 0  
[SND]rastaman-ne-nuzhna-mne-korona-princessa-i-gory.mp32022-08-12 00:36 0  
[SND]N1NT3ND0 - ЧП.mp32022-08-12 00:36 0  
[SND]LILDRUGHILL_ROCKET_Terminal.mp32022-08-12 00:35 0  
[SND]Jennie1945.mp32022-08-12 00:32 0  
[SND]Rin Ljubav for life.mp32022-08-12 00:27 0  
[SND]Brayen2.mp32022-08-12 00:17 0  
[SND]Brayen3.mp32022-08-12 00:17 0  
[SND]Brayen5.mp32022-08-12 00:17 0  
[SND]pu.mp32022-08-12 00:16 0  
[SND]Brayen4.mp32022-08-12 00:15 0  
[SND]Brayen1.mp32022-08-12 00:13 0  
[SND]Ytta1.mp32022-08-12 00:11 0  
[SND]Ytta40.mp32022-08-12 00:08 0  
[SND]Phu.mp32022-08-12 00:08 2.5M 
[SND]Gnjr.mp32022-08-12 00:06 2.4M 
[SND]Sbbg.mp32022-08-12 00:05 0  
[SND]Gnjrrmx.mp32022-08-12 00:05 0  
[SND]Abubudu.mp32022-08-11 23:54 0  
[SND]DIBANDINGKE.mp32022-08-11 23:53 3.0M 
[SND]JENNIENATAEL90.mp32022-08-11 23:47 4.5M 
[SND]mood.mp32022-08-11 23:46 2.1M 
[SND]ChippedAx.mp32022-08-11 23:44 0  
[SND]Chipped Ax - Lion Numchok and Joke So Cool (Official MV)(MP3_320K).mp32022-08-11 23:41 0  
[SND] Sabilulungan Trap.mp32022-08-11 23:32 0  
[SND]Genjer Genjer (1).mp32022-08-11 23:30 0  
[SND]genjer genjer remix .mp32022-08-11 23:30 0  
[SND]MAZ_KORZH_-_negry_vse_pidorasy_(iPleer.com).mp32022-08-11 23:21 0  
[SND]zawanbeats-low.mp32022-08-11 23:12 0  
[SND]DVRST_6YNTHMANE_ANTICXLTXRE_-_Will_Be_Soon_74627715.mp32022-08-11 23:12 0  
[SND]Maz_Korzh_Ya_pomnyu_mazellovvv.mp32022-08-11 23:04 7.1M 
[SND]Apple TV Imp.mp32022-08-11 23:00 0  
[SND]v19.mp32022-08-11 22:58 0  
[SND]v20.mp32022-08-11 22:57 0  
[SND]v18.mp32022-08-11 22:57 0  
[SND]v17.mp32022-08-11 22:56 0  
[SND]yt1s.io - Tshego Morore - Project Geese (2024) (128 kbps)(1).mp32022-08-11 22:54 0  
[SND]Industry Baby sped up is actually fire.mp32022-08-11 22:54 0  
[SND]c3.mp32022-08-11 22:45 3.6M 
[SND]c2.mp32022-08-11 22:45 4.8M 
[SND]index.mp32022-08-11 22:44 98K 
[SND]v15.mp32022-08-11 22:42 0  
[SND]v14.mp32022-08-11 22:30 0  
[SND]v13.mp32022-08-11 22:30 0  
[SND]v12.mp32022-08-11 22:29 0  
[SND]v11.mp32022-08-11 22:29 0  
[SND]v10.mp32022-08-11 22:15 0  
[SND]Bhjt.mp32022-08-11 22:14 0  
[SND]v7.mp32022-08-11 22:14 0  
[SND]v9.mp32022-08-11 22:13 0  
[SND]v8.mp32022-08-11 22:13 0  
[SND]instasamka-lipsi-ha-file.mp32022-08-11 22:08 4.8M 
[SND]Keskin - Raad Yok.mp32022-08-11 22:05 0  
[SND]Ne1.mp32022-08-11 21:59 0  
[SND]Mis.m4a2022-08-11 21:57 0  
[SND]PLAZA Installer Music - 2015 - November [bThTHiM8lkM].mp32022-08-11 21:54 0  
[SND]Viral Tiktok..! Dj Remix SIKOK BAGI DUO - Meli __ OT Zarly Dj Dody (320 kbps).mp32022-08-11 21:50 0  
[SND]Shadowraze - Showdown.mp32022-08-11 21:48 0  
[SND]v2.mp32022-08-11 21:46 2.2M 
[SND]v1.mp32022-08-11 21:45 2.3M 
[SND]hfDr3ig2Vd8F.128.mp32022-08-11 21:37 0  
[SND]Acoustic guitar sound effect free download.mp32022-08-11 21:33 0  
[VID]Smack My Bitch Up (2).mp42022-08-11 21:11 0  
[VID]creweskan.mp42022-08-11 21:09 0  
[SND]Суета.mp32022-08-11 21:08 0  
[SND]turi ip ip slowed reverb------ (remake)(MP3_128K).mp32022-08-11 21:06 0  
[SND]Mantra Hujan - Kobo Kanaeru __ Acoustic Version (Lirik _ Lyrics _ TikTok Song)(MP3_160K).mp32022-08-11 21:06 0  
[SND]AMONG US REMIX (VERSI MAMANK GAROX)(MP3_320K).mp32022-08-11 21:05 0  
[SND]darman.mp32022-08-11 21:03 0  
[SND]rom1.mp32022-08-11 20:55 0  
[SND]Escadas - Roll Up.mp32022-08-11 20:48 0  
[SND]ROLEX10.mp32022-08-11 20:44 0  
[SND]sadalex1.mp32022-08-11 20:43 0  
[SND]sgK6p9bqccbnQ1100OySZqOrvNPlW10H.mp32022-08-11 20:40 0  
[SND]TankTrouble (1).mp32022-08-11 20:40 0  
[SND]TankTrouble.mp32022-08-11 20:40 0  
[SND]Depeche Mode - Never Let Me Down Again.mp32022-08-11 20:39 6.9M 
[SND]Secret.mp32022-08-11 20:37 0  
[SND]y2mate.com - Blingos ft EL KATIBA.mp32022-08-11 20:35 0  
[SND]21-Shields-V2.0.mp32022-08-11 20:35 0  
[SND]y2mate.com - Blingos ft EL KATIBA عكس السرب Clip Officiel.mp32022-08-11 20:32 0  
[SND]BO9AL.mp32022-08-11 20:31 0  
[SND]2022-08-11 16-17-23_Trim.mp32022-08-11 20:30 0  
[SND]x.mp32022-08-11 20:30 93K 
[SND]abdo.mp32022-08-11 20:22 308K 
[SND]moro.mp32022-08-11 20:06 0  
[SND]DISCO.mp32022-08-11 19:59 0  
[SND]Kamazz - Как ты там.mp32022-08-11 19:55 0  
[SND]FACE_-_Biznes_72861005.mp32022-08-11 19:54 0  
[SND]Gay.mp32022-08-11 19:50 0  
[SND]Rollo Tomassi - L'homme rationnel .mp32022-08-11 19:48 0  
[VID]Rollo Tomassi - L'homme rationnel .mp42022-08-11 19:48 0  
[SND]JE.mp32022-08-11 19:47 0  
[SND]Suwy.mp32022-08-11 19:44 0  
[SND]AsianF.mp32022-08-11 19:43 0  
[SND]grey1.mp32022-08-11 19:42 0  
[SND]CH.mp32022-08-11 19:40 112K 
[SND]badang.mp32022-08-11 19:40 0  
[VID]lv_0_20220804225837.mp42022-08-11 19:39 0  
[SND]MiyaGi & Andy Panda - Minor.mp32022-08-11 19:35 0  
[SND]EdwardBil_Psikhopt.mp32022-08-11 19:33 0  
[SND]LD.mp32022-08-11 19:32 0  
[SND]ФОНК - phonk (mp3-2020.com).mp32022-08-11 19:31 0  
[SND]cartoon-jump-6462.mp32022-08-11 19:31 0  
[SND]X2Download.com - ใจร้าย - ILLSLICK _ Cover By.Seen ft.Miguel (ฺBadguy) (128 kbps).mp32022-08-11 19:28 424K 
[SND]Jonyy2.mp32022-08-11 19:18 0  
[SND]isolate.exe - crystals __ slowed + reverb.mp32022-08-11 19:11 0  
[SND]yatz2.mp32022-08-11 19:03 3.6M 
[SND]dingin.mp32022-08-11 19:02 460K 
[SND]s6.mp32022-08-11 19:01 2.5M 
[SND]mike1.mp32022-08-11 19:00 2.9M 
[SND]sample.mp32022-08-11 18:59 0  
[SND]Middle.mp32022-08-11 18:57 0  
[SND]CONSTANT.mp32022-08-11 18:56 0  
[SND]Dahan.mp32022-08-11 18:56 3.3M 
[SND]The Kiffness X Big Billy (Live Looping Talking Cat Remix).mp32022-08-11 18:56 0  
[SND]SnapSave.io - เหลือแค่ส้วมที่ใช้ร่วมกัน (128 kbps).mp32022-08-11 18:53 0  
[SND]moan.mp32022-08-11 18:53 3.1M 
[SND]Big Poppa Extreme Bass Boosted.mp32022-08-11 18:52 0  
[SND]rakhim-sinij-lamborghini-mp3.mp32022-08-11 18:48 0  
[SND]เหลือแค่ส้วมที่ใช้ร่วมกัน.mp32022-08-11 18:45 0  
[SND]lugowo.mp32022-08-11 18:43 3.1M 
[SND]Keizaro6.mp32022-08-11 18:40 4.0M 
[SND]yatz3.mp32022-08-11 18:39 3.2M 
[SND]coffe.mp32022-08-11 18:29 0  
[SND]10 - Skinheads S.H..mp32022-08-11 18:20 172K 
[SND]dgdsgdf.mp32022-08-11 18:14 0  
[SND]Учения безмолвного ума. (320 kbps).mp32022-08-11 18:10 0  
[SND]Last_Stop.mp32022-08-11 18:09 0  
[SND]My-Everything_HxWSDUC-KTU.mp32022-08-11 18:05 0  
[SND]jony.mp32022-08-11 18:04 0  
[SND]Dhyo_-_Haw__Jarak_Dan_Kita___lagu_terbaru.mp32022-08-11 18:01 0  
[SND]ikeh1.mp32022-08-11 18:00 0  
[SND]senyum.mp32022-08-11 18:00 3.1M 
[SND]Campfire Crackling warm cozy beats.mp32022-08-11 17:59 0  
[SND]jony1.mp32022-08-11 17:59 0  
[SND]y2mate.com - EVAN LOSS FULL SENYUM SAYANG.mp32022-08-11 17:58 0  
[SND]thrill_pill_polnoch.mp32022-08-11 17:56 0  
[SND]keren.mp32022-08-11 17:48 2.6M 
[VID]4eb407f96ba5febdfecc87d5f4cc4125.mp42022-08-11 17:48 0  
[SND]Ajs_Nigrutin_Kilo_Granja_Lesim.mp32022-08-11 17:47 0  
[SND]DJ Reggae Come On Come On Turn The Radio X Sampe Bawah Fyp TikTok• Jaranan Dor • Alfin Revolution.mp32022-08-11 17:47 0  
[SND]DJ AMERICAN DREAMS X MELODY MENGKANE VIRAL TIKTOK.mp32022-08-11 17:44 0  
[SND]19wmnsgsuakakan.mp32022-08-11 17:44 0  
[SND]Farruko - Pepas.mp32022-08-11 17:43 0  
[SND]farruko-pepas.mp32022-08-11 17:40 0  
[SND][mileon] - L устал.mp32022-08-11 17:38 0  
[SND]Skriptonit_-_Mister_718_51836708.mp32022-08-11 17:34 0  
[SND]dj3.mp32022-08-11 17:32 3.4M 
[SND][EldarwaR] - II - Die Lösung.mp32022-08-11 17:29 0  
[SND]escltplayer8181818.mp32022-08-11 17:26 0  
[SND]GTA.mp32022-08-11 17:17 2.5M 
[SND]theyn.mp32022-08-11 17:16 0  
[VID]SnapInsta_280653172_1075198643075739_7338141745345842817_n.mp42022-08-11 17:15 0  
[SND]Y2Mate.is - Chad sound affect-gLeydZjRwtE-48k-1660238121260.mp32022-08-11 17:15 0  
[SND]payt1.mp32022-08-11 17:15 0  
[SND]payt.mp32022-08-11 17:15 0  
[SND]escltplayer.mp32022-08-11 17:14 0  
[SND]singto.mp32022-08-11 17:09 0  
[SND]videoplayback.m4a2022-08-11 17:09 0  
[SND]ardy03.mp32022-08-11 17:09 0  
[SND]ardy02.mp32022-08-11 17:08 0  
[SND]144.mp32022-08-11 17:08 2.4M 
[SND]ardy01.mp32022-08-11 17:07 0  
[SND]199.mp32022-08-11 17:06 0  
[VID]Y2Mate.is - Batman Beatbox-ApMzw-tyHmg-720p-1660236001700 (1).mp42022-08-11 17:01 0  
[SND]jian25.mp32022-08-11 17:01 0  
[SND]jian8.mp32022-08-11 17:01 0  
[SND]forum_-_belaya-noch.mp32022-08-11 16:56 0  
[SND]tumsath.mp32022-08-11 16:51 0  
[SND]J_Balvin_Skrillex_-_In_Da_Getto_73025728.mp32022-08-11 16:49 0  
[SND]Randa2.mp32022-08-11 16:48 0  
[SND]Zack0.mp32022-08-11 16:47 0  
[SND]chippedax2.mp32022-08-11 16:46 0  
[SND]Zexx3.mp32022-08-11 16:42 0  
[SND]chippedax122.mp32022-08-11 16:41 0  
[SND]Zexx2.mp32022-08-11 16:41 0  
[SND]Wangy1.mp32022-08-11 16:41 0  
[SND]Randa4.mp32022-08-11 16:39 0  
[SND]DhemDJ11.mp32022-08-11 16:37 0  
[SND]Нагыз Казактын - Шешен амы (radio.lol).mp32022-08-11 16:35 0  
[SND]chippedax.mp32022-08-11 16:33 0  
[SND]Junko Yagami - Bay City (Extended Disco Mix) (www.hotplayer.ru).mp32022-08-11 16:33 0  
[SND]こんにちは、サルカズ傭兵のハナです.m4a2022-08-11 16:31 0  
[SND]ik100.mp32022-08-11 16:22 0  
[SND]Big_Baby_Tape_Molodoj_Platon_VLYuBILAS.mp32022-08-11 16:22 0  
[SND]ardyFNF.mp32022-08-11 16:19 0  
[SND]kayganda.mp32022-08-11 16:13 0  
[SND]Ghost_Mary_On_A_Cross.mp32022-08-11 16:10 0  
[SND]kamalayan.mp32022-08-11 16:10 2.9M 
[SND]Jaydee123.mp32022-08-11 16:08 0  
[SND]matanda.mp32022-08-11 16:07 0  
[SND]lukku.mp32022-08-11 16:07 0  
[SND]Njan Jackson Allada DJ Remix _ DJ Strawz _ Soubin(MP3_70K).mp32022-08-11 16:07 716K 
[SND]st7.mp32022-08-11 16:05 0  
[SND]FNF.mp32022-08-11 16:01 0  
[SND]thrill-pill-polnoch.mp32022-08-11 15:55 0  
[SND]Jroa.mp32022-08-11 15:55 0  
[SND]KAMENRIDER.mp32022-08-11 15:53 0  
[SND]JennieNatael1.mp32022-08-11 15:53 0  
[SND]fancyadamvanhammerslicemenice.mp32022-08-11 15:53 0  
[SND]chdn.mp32022-08-11 15:51 0  
[SND]JEN.mp32022-08-11 15:48 0  
[SND]aku.mp32022-08-11 15:44 0  
[SND]AMMU.mp32022-08-11 15:37 0  
[SND]Herocashcash.mp32022-08-11 15:34 376K 
[SND]dhije2.mp32022-08-11 15:34 3.4M 
[SND]bgm1vmrp.mp32022-08-11 15:30 348K 
[SND]miyagi.mp32022-08-11 15:29 0  
[SND]Sample-audio-demo.mp32022-08-11 15:29 0  
[SND]JIMIN (BTS) & HA SUNG WOON - With You (OST Our Blues Part.4) [320 kbps].mp32022-08-11 15:28 0  
[SND]505.mp32022-08-11 15:28 576K 
[SND]9999.mp32022-08-11 15:26 0  
[SND]Reyy2.mp32022-08-11 15:20 0  
[SND]55.mp32022-08-11 15:17 2.4M 
[SND]dj2.mp32022-08-11 15:16 5.5M 
[SND]Lyusya_CHebotina_-_SOLNCE_MONAKO_73236442.mp32022-08-11 15:16 0  
[SND]JAY DVRDEN-akatsuki.exe-kissvk.com.mp32022-08-11 15:15 0  
[SND]dj1.mp32022-08-11 15:15 0  
[SND]EDSON NUÑEZ DANIEL LÜDTKE GRACIA CLIPE OFICIAL.mp32022-08-11 15:13 0  
[SND]aarne-feat.-anikv-bushido-zho-tesno.mp32022-08-11 15:12 0  
[SND]Sad.mp32022-08-11 15:12 0  
[SND]Gazan_-_ABU_BANDIT_71958609.mp32022-08-11 15:11 0  
[SND]AFSAL3.mp32022-08-11 15:10 0  
[SND]AFSAL2.mp32022-08-11 15:09 0  
[SND]ASW.mp32022-08-11 15:09 0  
[SND]DJAKUMAU.mp32022-08-11 15:05 0  
[SND]Lil Uzi Vert - XO Tour Llif3 (Official Music Video) (mp3cut.net) (1).mp32022-08-11 15:00 0  
[SND]ข.mp32022-08-11 14:46 0  
[SND]play_back.mp32022-08-11 14:45 0  
[SND]asekGG.mp32022-08-11 14:37 0  
[SND]bale1.mp32022-08-11 14:33 0  
[SND]Cau 3.1 - Minna - Nghe.mp32022-08-11 14:33 0  
[SND]Zer.mp32022-08-11 14:30 0  
[SND]beat.mp32022-08-11 14:29 5.4M 
[SND]cj7.mp32022-08-11 14:25 0  
[SND]BBBB.mp32022-08-11 14:22 0  
[SND]likin.mp32022-08-11 14:22 0  
[SND]gedh.mp32022-08-11 14:19 0  
[SND]Aarne_BUSHIDO_ZHO_ANIKV_-_Tesno_74640918.mp32022-08-11 14:12 0  
[SND]aljona_shvec_-_Barabanshhica_73921923.mp32022-08-11 14:00 0  
[SND]DJRANX.mp32022-08-11 13:53 0  
[SND]birthday1.mp32022-08-11 13:51 0  
[SND]YOYO.mp32022-08-11 13:51 0  
[SND]indonesia.mp32022-08-11 13:50 0  
[SND]lagu.mp32022-08-11 13:49 332K 
[SND]y2mate.com - LAGU INDONESIA RAYA TEXT DAN VOCAL ORIGINAL OFFICIAL.mp32022-08-11 13:48 0  
[SND]sparks.mp32022-08-11 13:44 0  
[SND]tekit.mp32022-08-11 13:42 2.5M 
[SND]myworld.mp32022-08-11 13:40 0  
[SND]Kopikap1.mp32022-08-11 13:37 2.5M 
[SND]Hans zimmer - Interstellar No Time for Caution.mp32022-08-11 13:35 0  
[SND]crycgs.mp32022-08-11 13:34 0  
[SND]MAMA.mp32022-08-11 13:34 2.1M 
[SND]y2mate.com - DJ SIKOK BAGI DUO REMIX VIRAL TIKTOK TERBARU 2022 JEDAG JEDUG FULL BASS DJ CAMPURAN.mp32022-08-11 13:34 0  
[SND]Berkelana1.mp32022-08-11 13:32 0  
[SND]bublegum.mp32022-08-11 13:31 0  
[SND]sb.mp32022-08-11 13:30 0  
[SND]james.mp32022-08-11 13:29 508K 
[SND]pendhoza_pendhoza-ninggal-janji-new-version(2).mp32022-08-11 13:27 0  
[SND]Kopikap4.mp32022-08-11 13:27 0  
[SND]Phonk.mp32022-08-11 13:25 1.3M 
[SND]Putri Kristya Gubuk Asmoro DC Musik.mp32022-08-11 13:25 0  
[SND]thomas.mp32022-08-11 13:24 3.6M 
[SND]Bojo2.mp32022-08-11 13:23 0  
[SND]meoww1.mp32022-08-11 13:23 0  
[SND]Https.github.mp32022-08-11 13:21 0  
[SND]Denny Caknan Happy Asmara Yeni Inka Bojo Loro DC Musik(6).mp32022-08-11 13:21 0  
[SND]download.mp32022-08-11 13:20 0  
[SND]Bojo1.mp32022-08-11 13:20 0  
[SND]geng04.mp32022-08-11 13:18 756K 
[SND]Everyday Normal Guy 2.mp32022-08-11 13:18 157K 
[VID]Eminem - Venom.mp42022-08-11 13:16 0  
[SND]Tiara1.mp32022-08-11 13:15 0  
[SND]Farel2.mp32022-08-11 13:15 0  
[SND]Satru2.mp32022-08-11 13:13 0  
[SND]Shade.mp32022-08-11 13:09 2.8M 
[SND][lagu1s.com]Gugur Bunga Versi Asli.xnkeuf-Jtqc.mp32022-08-11 13:08 520K 
[SND]alok.mp32022-08-11 13:08 1.5M 
[SND]Davin4.mp32022-08-11 13:07 0  
[SND]j-hope-bts-more-mp3.mp32022-08-11 13:07 0  
[SND]Davin5.mp32022-08-11 13:06 0  
[SND]Cheriimoya_Living_life_in_the_night_remix.mp32022-08-11 13:02 0  
[SND]marcocks.mp32022-08-11 13:01 0  
[SND]amaremix.mp32022-08-11 13:01 0  
[SND]Tom Odell - Another Love (Lyrics).mp32022-08-11 13:01 4.4M 
[SND]2pac-2.mp32022-08-11 12:59 0  
[SND]cc.mp32022-08-11 12:55 3.2M 
[SND]White_Boy_X_Nasty_Babe_-_Dura_73283215.mp32022-08-11 12:53 0  
[SND]Davin3.mp32022-08-11 12:51 0  
[SND]2pac-1.mp32022-08-11 12:51 0  
[SND]April1.mp32022-08-11 12:51 0  
[SND]Ran1.mp32022-08-11 12:50 0  
[SND]MatritzenOperation (DJ Cannabis Coffeeshops Deutschland).mp32022-08-11 12:49 0  
[SND]Guyonw1.mp32022-08-11 12:49 936K 
[SND]aa.mp32022-08-11 12:49 2.6M 
[SND]bb.mp32022-08-11 12:48 836K 
[SND]Mr_Lambo_Chicago_73869133.mp32022-08-11 12:46 0  
[SND]Duyan.mp32022-08-11 12:44 4.7M 
[SND]misha_xramovi_-_gaichite.mp32022-08-11 12:35 0  
[SND]JenJoon - Soukara _ ٰسُكارَى (Official Video).mp3.mp32022-08-11 12:32 0  
[SND]JenJoon - Soukara _ ٰسُكارَى (Official Video).mp32022-08-11 12:30 0  
[SND]djakumeriang.mp32022-08-11 12:28 0  
[SND]Rucez.mp32022-08-11 12:25 604K 
[SND]9N.mp32022-08-11 12:23 0  
[SND]1975.mp32022-08-11 12:19 0  
[SND]JJJJ.mp32022-08-11 12:18 1.8M 
[SND]Dance13.mp32022-08-11 12:11 0  
[SND]Dance12.mp32022-08-11 12:11 0  
[SND]Dance11.mp32022-08-11 12:11 0  
[SND]Dance10.mp32022-08-11 12:11 0  
[SND]Dance9.mp32022-08-11 12:10 2.6M 
[SND]Dance8.mp32022-08-11 12:10 4.1M 
[SND]Dance7.mp32022-08-11 12:10 5.6M 
[SND]Dance6.mp32022-08-11 12:10 3.0M 
[SND]Dance5.mp32022-08-11 12:10 4.5M 
[SND]Dance4.mp32022-08-11 12:10 3.8M 
[SND]Dance3.mp32022-08-11 12:10 4.2M 
[SND]Dance2.mp32022-08-11 12:10 3.2M 
[SND]Dance02.mp32022-08-11 12:09 2.3M 
[SND]CJWhoopty.mp32022-08-11 12:03 0  
[SND]VinKy15.mp32022-08-11 11:59 0  
[SND]Dimas7.mp32022-08-11 11:57 0  
[SND]Dimas1.mp32022-08-11 11:55 0  
[SND]VinKy8.mp32022-08-11 11:55 0  
[SND]SLK.mp32022-08-11 11:50 0  
[SND]NANE - DOUGH THO' 💰 (video oficial).mp32022-08-11 11:50 0  
[SND]meneketehe.mp32022-08-11 11:50 3.8M 
[SND]Yen1.mp32022-08-11 11:50 0  
[SND]Denn1.mp32022-08-11 11:50 0  
[SND]Denn2.mp32022-08-11 11:50 0  
[SND]Ek Tera Naam hai Sacha Lyrics _ ABCD2 _ Varun Dhavan __.mp32022-08-11 11:49 0  
[SND]Jennie.mp32022-08-11 11:46 0  
[SND]dkl00.mp32022-08-11 11:44 0  
[SND]dkl0.mp32022-08-11 11:44 952K 
[SND]Dimas.mp32022-08-11 11:40 2.9M 
[SND]DimasAnjayMabar.mp32022-08-11 11:39 0  
[SND][MV] Rapsodi - JKT48.mp32022-08-11 11:38 0  
[SND]xRiltz209.mp32022-08-11 11:37 0  
[SND]MACAN - Без названия.mp32022-08-11 11:37 0  
[SND]OGJFPGJFDPGJDOFPJG.mp32022-08-11 11:37 0  
[SND]sweet_groove.mp32022-08-11 11:33 0  
[SND]IMPERATOR.mp32022-08-11 11:32 4.9M 
[SND]7065830654449109786.mp32022-08-11 11:32 0  
[SND](FREE) Lo-fi Type Beat - I Need a Girl(MP3_160K).mp32022-08-11 11:31 0  
[SND]Dj Gue Mah Bodo Amat X Aku Hamil Duluan Mengkane Viral Tiktok 2022.mp32022-08-11 11:29 0  
[SND]Dance01.mp32022-08-11 11:27 3.0M 
[SND]xRiltz1009.mp32022-08-11 11:26 0  
[SND]xRiltz1010.mp32022-08-11 11:26 0  
[SND]xRiltz1007.mp32022-08-11 11:25 0  
[SND]xRiltz1005.mp32022-08-11 11:25 0  
[SND]xRiltz1004.mp32022-08-11 11:25 0  
[SND]xRiltz1001.mp32022-08-11 11:25 0  
[SND]xRiltz1006.mp32022-08-11 11:25 0  
[SND]xRiltz1002.mp32022-08-11 11:25 0  
[SND]xRiltz1003.mp32022-08-11 11:25 0  
[SND]xRiltz101.mp32022-08-11 11:22 0  
[SND]Mother Mother - Wisdom_(audiohunter.ru).mp32022-08-11 11:18 0  
[SND]zaur-magomadov-idet-karavan-iz-irana.mp32022-08-11 11:16 0  
[SND]Dushistyj_plan_Karavan_Ormars_remix.mp32022-08-11 11:12 3.8M 
[SND]ilulsad5.mp32022-08-11 11:08 0  
[SND]usituru.mp32022-08-11 11:07 1.4M 
[SND]Malamini.mp32022-08-11 11:07 9.0M 
[SND]DJ_INILAH_AKU_RAJA_MEKSIKO_WINDAH_BASUDARA_VIRAL_TIK_TOK_TERBARU_2022(256k).mp32022-08-11 11:06 0  
[SND]y2mate.com - Mahmut Orhan Ft Sena Sener Feel Extended Drop.mp32022-08-11 11:06 0  
[SND]jamet.mp32022-08-11 11:04 0  
[SND]Shiv Jan sewa.mp32022-08-11 11:02 0  
[SND]bodievkruzak200spectatorremix.mp32022-08-11 11:00 0  
[SND]prialain.mp32022-08-11 10:59 0  
[SND]ichapi5.mp32022-08-11 10:56 0  
[SND]StandHereAlone.mp32022-08-11 10:55 0  
[SND]Strong - One Direction (speed up version).mp32022-08-11 10:54 0  
[SND]ichapi4.mp32022-08-11 10:51 0  
[SND]danger.mp32022-08-11 10:51 831K 
[SND]cartel.mp32022-08-11 10:50 921K 
[SND]dandelions cover.mp32022-08-11 10:44 2.4M 
[SND]AH.mp32022-08-11 10:43 648K 
[SND]kesukaan.mp32022-08-11 10:43 0  
[SND]Black No. 1 (Little Miss Scare -All).mp32022-08-11 10:43 0  
[SND]Den1.mp32022-08-11 10:43 2.2M 
[SND]Fav1.mp32022-08-11 10:42 1.0M 
[SND]Jastin.mp32022-08-11 10:41 1.7M 
[SND]fsijfs.mp32022-08-11 10:41 0  
[SND]DUST.mp32022-08-11 10:38 0  
[SND]SDFJSDF.mp32022-08-11 10:38 0  
[SND](downloadlagu321z.net) - TRICKSTER TILL I DIED - Prod.By MANGBORIS (Official Audio) (1).mp32022-08-11 10:37 0  
[SND]moon.mp32022-08-11 10:36 80K 
[SND]m3.mp32022-08-11 10:33 3.5M 
[SND]Ninn.mp32022-08-11 10:25 9.3M 
[SND]remix1.mp32022-08-11 10:22 2.7M 
[SND]Jokoti(4).mp32022-08-11 10:19 0  
[SND]Jack.mp32022-08-11 10:18 0  
[SND]P9.mp32022-08-11 10:14 0  
[SND]MNUEIW.mp32022-08-11 10:14 0  
[SND]Farel Prayoga Satru 2.mp32022-08-11 10:14 0  
[SND]SAD1111.mp32022-08-11 10:12 0  
[SND]Orange.mp32022-08-11 10:12 0  
[SND]Jokoti(2).mp32022-08-11 10:12 0  
[SND]Y6mta.mp32022-08-11 10:10 0  
[SND]muli (2).mp32022-08-11 10:08 0  
[SND]Dj Fisto-B-Itz-EnRouteHouse120.mp32022-08-11 10:07 4.4M 
[SND]kg.mp32022-08-11 10:05 0  
[SND]nowbita.mp32022-08-11 10:05 0  
[SND]P1.mp32022-08-11 10:03 0  
[SND]Nobita.mp32022-08-11 10:03 0  
[SND]KayGanda.mp32022-08-11 10:03 0  
[SND]kumpas.mp32022-08-11 10:00 2.0M 
[SND]Re-Up.mp32022-08-11 09:59 0  
[SND]Moira Dela Torre - Kumpas (Official Lyric Visualizer) (1).mp32022-08-11 09:57 0  
[SND]Marko Rudio - Ikaw lang (Nobita) cover.mp32022-08-11 09:57 0  
[SND]Muli- Ace Banzuelo drum cover.mp32022-08-11 09:57 0  
[SND]enak.mp32022-08-11 09:55 3.3M 
[SND]m52.mp32022-08-11 09:55 0  
[SND]m51.mp32022-08-11 09:55 0  
[SND]Black Mirror Soundtrack Hang the Dj - Hours, Days, Months.mp32022-08-11 09:53 0  
[SND]Cash Cash-Hero.mp32022-08-11 09:53 0  
[SND]sakit.mp32022-08-11 09:52 3.5M 
[SND]Comment.mp32022-08-11 09:51 2.6M 
[SND]Cash Cash - Hero feat. Christina Perri [Official Audio].mp32022-08-11 09:46 0  
[SND]DJ Aku meriang.mp32022-08-11 09:42 2.3M 
[SND]AUD-20220811-WA0000.mp32022-08-11 09:39 0  
[SND]DJ.AKU MERIANG MERINDUKAN KASIH SAYANG CITATA VIRAL TIKTOK fyptiktok 🎧.mp32022-08-11 09:30 0  
[SND]【明白神的旨意】第2讲(上半部分).mp32022-08-11 09:28 0  
[SND]mashup.mp32022-08-11 09:24 0  
[SND]y2mate.com - Sound Yang Lagi Viral Di TikTok RizkiSz Dj Midua Cinta Mengkane Bootleg Raka Remixer.mp32022-08-11 09:24 0  
[SND]Destroy_Lonely_-_Loyalti.mp32022-08-11 09:18 0  
[SND]promqueen.mp32022-08-11 09:17 2.0M 
[SND]prom queen.mp32022-08-11 09:16 1.9M 
[SND]X2Download.mp32022-08-11 09:14 0  
[SND]Pogi9.mp32022-08-11 09:13 0  
[SND]Duo.mp32022-08-11 09:12 0  
[SND]Pogi7.mp32022-08-11 09:10 0  
[SND]Pogi8.mp32022-08-11 09:09 0  
[SND]Vamos.mp32022-08-11 09:09 0  
[SND]y2mate.com - HUYỀN TÂM MÔN LẦN HẸN HÒ ĐẦU TIÊN Prod BEGINNING OFFICIAL AUDIO.mp32022-08-11 09:04 0  
[SND]duran-ozer-siki-baba.mp32022-08-11 09:02 0  
[VID]اغنية كردية ريمكس عشقه ملايين من الأكراد سوراني (كوردمو كوردستانيم).mp42022-08-11 09:01 0  
[SND]John124.mp32022-08-11 08:56 2.0M 
[SND]0001.mp32022-08-11 08:55 0  
[SND]V.mp32022-08-11 08:53 0  
[SND]mp3-now.com - Kannil Kannil Lyrical Video Sita Ramam Malayalam Dulquer Mrunal Vishal Hanu Raghavapudi_256kbps.mp32022-08-11 08:52 0  
[SND]zxen3.mp32022-08-11 08:50 0  
[SND]Pogi3.mp32022-08-11 08:48 0  
[SND]Pogi2.mp32022-08-11 08:47 0  
[SND]Umb.mp32022-08-11 08:47 0  
[SND]Pogi1.mp32022-08-11 08:46 0  
[SND]Yaukoshi, LXST CXNTURY Цой - Кончится Odium.mp32022-08-11 08:46 0  
[SND]kurd1.mp32022-08-11 08:46 0  
[SND]mp3-now.com - Kannil Kannil Lyrical Video Sita Ramam Malayalam Dulquer Mrunal Vishal Hanu Raghavapudi_96kbps.mp32022-08-11 08:44 0  
[SND]AR23.mp32022-08-11 08:41 0  
[SND]gio-pika-fontanchik-s-chernym-delfinom(mp3name.co).mp32022-08-11 08:40 0  
[VID]VN20220511_184453_001.mp42022-08-11 08:38 0  
[SND]DjSleep82.mp32022-08-11 08:35 0  
[SND]KINO_-_Zakrojj_za_mnojj_dver_ya_ukhozhu_(musmore.com).mp32022-08-11 08:34 0  
[SND]Кино - Закрой за мной дверь я ухожу.mp32022-08-11 08:33 0  
[SND]AR1.mp32022-08-11 08:33 0  
[SND]E.C. 2151 - Demon's Tilt.mp32022-08-11 08:31 0  
[SND]Ezra5.mp32022-08-11 08:27 0  
[SND]djdesa81.mp32022-08-11 08:23 0  
[SND]banding.mp32022-08-11 08:21 0  
[SND]DJ TANGKIS DAANG X PAPALI BERNYANYI SOUND MAHA TREND TAHUN LAHIR VIRAL TIKTOK.mp32022-08-11 08:18 0  
[SND]Wrrp3.mp32022-08-11 08:18 0  
[SND]Keizaro2.mp32022-08-11 08:18 3.8M 
[SND]Keizaro5.mp32022-08-11 08:18 4.2M 
[SND]Keizaro4.mp32022-08-11 08:17 3.8M 
[SND]Keizaro9.mp32022-08-11 08:17 3.1M 
[SND]Keizaro11.mp32022-08-11 08:17 2.8M 
[SND]Wrrp4.mp32022-08-11 08:17 0  
[SND]Wrrp6.mp32022-08-11 08:16 0  
[SND]Powfu - Death Bed (8D Audio Lyrics) feat. Beabadoobee dont stay away for to.mp32022-08-11 08:16 0  
[SND]Wrrp1.mp32022-08-11 08:15 0  
[SND]y2meta.com - Nonstop 2022 - I Don't Know Her Name Remix - Nhạc Hot Trend Xu Hướng Tik Tok 2022 (320 kbps).mp32022-08-11 08:14 1.1M 
[SND]R.I.P.mp32022-08-11 08:14 2.8M 
[SND]Sakit Gigi.mp32022-08-11 08:13 5.5M 
[SND]letiteat.mp32022-08-11 08:12 1.3M 
[SND]pakpong.mp32022-08-11 08:11 496K 
[SND]Boom.mp32022-08-11 08:10 24K 
[SND]Cewo_-_Underworld_Remix_low_bass_by_ed4et_73431420.mp32022-08-11 08:08 0  
[SND]myoops.mp32022-08-11 08:04 3.5M 
[SND]Thotiana.mp32022-08-11 08:04 2.0M 
[SND]tr1.mp32022-08-11 07:54 15M 
[SND]SHokk_-_Mne_tebe_nechego_skazat_prosti_no_ty_ne_pojmyosh_Tot_zhar_i_zhazhda_izchezli_ostalas_syrost_(iPleer.com).mp32022-08-11 07:53 4.6M 
[SND]Kung_Ikay_Akin_-_Lyrics_by_Chocolate_Factory_[ConverteZilla.com].mp32022-08-11 07:52 3.8M 
[SND]djkane2.mp32022-08-11 07:48 37M 
[SND]fn.mp32022-08-11 07:47 5.2M 
[SND]JoJo-Allopening_(allmp3.su).mp32022-08-11 07:46 16M 
[SND]Anjay.mp32022-08-11 07:46 4.3M 
[SND]aty.mp32022-08-11 07:45 8.8M 
[SND]это.mp32022-08-11 07:43 9.3M 
[SND]djkane1.mp32022-08-11 07:42 3.9M 
[SND]sad01.mp32022-08-11 07:40 0  
[SND]это.mp3.mp32022-08-11 07:39 0  
[SND]Heartbreaking.mp3.mp32022-08-11 07:37 0  
[SND]djnioi.mp32022-08-11 07:37 0  
[SND]Teki.mp32022-08-11 07:33 0  
[SND]djkane.mp32022-08-11 07:32 212K 
[SND]frien.mp32022-08-11 07:29 0  
[SND]fonovaja_muzika_dlja_video4_-_bez_nazvanija_(z2.fm).mp32022-08-11 07:28 0  
[SND]Miyagi & Andy Panda - Патрн.mp32022-08-11 07:27 0  
[SND]bt.mp32022-08-11 07:23 764K 
[SND]KGC.mp32022-08-11 07:21 0  
[SND]orang.mp32022-08-11 07:19 0  
[SND]willrain.mp32022-08-11 07:19 0  
[SND]y2mate.com - DJ MENEKETEHE X STENDING MOTOR X BANGUN TIDUR SELFIE MENGKANE.mp32022-08-11 07:19 3.8M 
[SND]The Purge - Announcement HD.mp32022-08-11 07:15 0  
[SND]ktdas.mp32022-08-11 07:05 1.2M 
[SND]Sanaallmahal.mp32022-08-11 07:05 1.5M 
[SND]Simulashan.mp32022-08-11 07:02 2.8M 
[SND]Halakashan.mp32022-08-11 07:02 2.1M 
[SND]Kagome.mp32022-08-11 06:59 3.7M 
[SND]9naga.mp32022-08-11 06:59 906K 
[SND]Holdme.mp32022-08-11 06:59 3.3M 
[SND]JJ.mp32022-08-11 06:59 1.7M 
[SND]J.mp32022-08-11 06:58 1.2M 
[SND]Halik.mp32022-08-11 06:58 4.2M 
[SND]Guns.mp32022-08-11 06:58 5.0M 
[SND]Hero.mp32022-08-11 06:58 1.7M 
[SND]Heathens.mp32022-08-11 06:58 3.3M 
[SND]Heather.mp32022-08-11 06:58 2.7M 
[SND]Heart.mp32022-08-11 06:58 2.4M 
[SND]Dreams.mp32022-08-11 06:57 3.3M 
[SND]Easyonme.mp32022-08-11 06:57 3.4M 
[SND]end.mp32022-08-11 06:57 3.3M 
[SND]Ganonparen.mp32022-08-11 06:57 2.7M 
[SND]Datingtayo.mp32022-08-11 06:57 3.9M 
[SND]Dope.mp32022-08-11 06:56 3.2M 
[SND]Неизвестен — Зачем она берёт мужские письки в рот (www.lightaudio.ru) (1).mp32022-08-11 06:56 1.1M 
[SND]chill.mp32022-08-11 06:56 2.6M 
[SND]Easy.mp32022-08-11 06:56 127K 
[SND]Again.mp32022-08-11 06:56 3.1M 
[SND]Broken.mp32022-08-11 06:56 2.4M 
[SND]keduoitheoanhsang.mp32022-08-11 06:56 0  
[SND]Angel.mp32022-08-11 06:55 4.0M 
[SND]Bed.mp32022-08-11 06:55 2.7M 
[SND]ACDMND.mp32022-08-11 06:55 4.6M 
[SND]blue.mp32022-08-11 06:55 2.3M 
[SND]balls.mp32022-08-11 06:55 2.7M 
[SND]Atlantic.mp32022-08-11 06:55 2.7M 
[SND]zone.mp32022-08-11 06:54 0  
[SND]Vp8.mp32022-08-11 06:53 2.4M 
[SND]empiree.mp32022-08-11 06:52 0  
[SND]Dj3.mp32022-08-11 06:51 1.8M 
[SND]naga.mp32022-08-11 06:51 0  
[SND]mikee2.mp32022-08-11 06:47 0  
[SND]02.Mon_Bojhe_Na-Arijit_Singh_FusionBD.Com.mp32022-08-11 06:43 0  
[SND]Relax.mp32022-08-11 06:42 580K 
[SND]ms.mp32022-08-11 06:40 3.3M 
[SND]y2mate.com - Kẻ Theo Đuổi Ánh Sáng Lofi Ver Huy Vạc x Tiến Nguyễn x Freak D.mp32022-08-11 06:26 0  
[SND]gonefludd_-_kubik_lda_(zf.fm).mp32022-08-11 06:19 0  
[SND]ecec2.mp32022-08-11 06:19 0  
[SND]Marko1.mp32022-08-11 06:17 0  
[SND]0608_525f_0159_1b9ea4ee07e5c709f0f2633181f994e0.mp32022-08-11 06:16 0  
[SND]_Mohabbat_Barsa_De__Full_Video_Song_Ft._Arjun___Creature_3D,_Surveen_Chawla_.mp32022-08-11 06:14 0  
[SND]y2mate.com - Kẻ Theo Đuổi Ánh Sáng Lofi Ver Huy Vạc x Tiến Nguyễn x Freak D_320kbps.mp32022-08-11 06:13 0  
[SND]02.Honved Ensemble - 02 A Nyugati Gregorian Es A Magyar Nepdal Talalkozasa.mp32022-08-11 06:11 0  
[SND]james19.mp32022-08-11 06:10 0  
[SND]james20.mp32022-08-11 06:10 0  
[SND]HAR10.mp32022-08-11 06:09 0  
[SND]HAR13.mp32022-08-11 06:09 4.4M 
[SND]Kobo7.mp32022-08-11 06:09 943K 
[SND]HAR4.mp32022-08-11 06:09 0  
[SND]HAR5.mp32022-08-11 06:09 0  
[SND]HAR6.mp32022-08-11 06:08 0  
[SND]HAR7.mp32022-08-11 06:08 0  
[SND]HAR8.mp32022-08-11 06:08 0  
[SND]HAR9.mp32022-08-11 06:08 0  
[SND]lil_bank_-_LVL_drift_fonk_Bassbust_(TheMP3.Info).mp32022-08-11 06:07 0  
[SND]Har14.mp32022-08-11 06:07 0  
[SND]Har13.mp32022-08-11 06:07 0  
[SND]Har12.mp32022-08-11 06:06 0  
[SND]AniSh-MaHli-New-Nagpuri-Bewafa-Song-2022-Dj-Nagpuri-Song-2022-Dj-Pawan-Bedia_2q5yhjZC7uI.mp32022-08-11 06:04 0  
[SND]Yh.mp32022-08-11 06:02 3.9M 
[SND]Tandi1.mp32022-08-11 06:02 0  
[SND]C5162.mp32022-08-11 06:01 0  
[SND]Close55.mp32022-08-11 06:00 0  
[SND]s7.mp32022-08-11 05:54 0  
[SND]ayaayi.mp32022-08-11 05:53 0  
[SND]you_win_1.mp32022-08-11 05:52 0  
[SND]misel.mp32022-08-11 05:48 388K 
[SND]DJ Meneketehe VinKy ft. Abub YETE.mp32022-08-11 05:45 3.8M 
[SND]Cosmo Sheldrake - Nightjar Wake up Call.mp32022-08-11 05:41 0  
[SND]Sadrrt.mp32022-08-11 05:40 0  
[SND]theweeknd.mp32022-08-11 05:40 0  
[SND]VinKy10.mp32022-08-11 05:39 3.1M 
[SND]Shower again.m4a2022-08-11 05:37 142K 
[SND]Iwas1.mp32022-08-11 05:36 0  
[SND]245.mp32022-08-11 05:34 0  
[SND]hoh.mp32022-08-11 05:34 0  
[SND]hohh.mp32022-08-11 05:34 2.1M 
[SND]Iwas.mp32022-08-11 05:33 0  
[SND]Wednesdaysex.m4a2022-08-11 05:33 280K 
[SND]SIARAN ONLINE Mixdown 1.mp32022-08-11 05:27 0  
[SND]ketche.mp32022-08-11 05:26 0  
[SND]mybrother.mp32022-08-11 05:26 0  
[SND]FileMorphOutput.mp32022-08-11 05:22 0  
[SND]4_6010582219926544407.mp32022-08-11 05:08 0  
[SND]4_6014999348977342305.mp32022-08-11 05:07 0  
[SND]Alvino.mp32022-08-11 05:07 0  
[SND]Фая.mp32022-08-11 05:07 0  
[SND][lagu1s.com]DJ KU HAMIL DULUAN REMIX __ VIRAL TIKTOK.itL8liAGKro.mp32022-08-11 05:05 0  
[SND]rzali.mp32022-08-11 05:03 0  
[SND]zz.mp32022-08-11 05:02 2.4M 
[SND]Y2Mate.is - Japanese Guy Yelling-UpjYTwNjWc8-160k-1660193861394-[AudioTrimmer.com].mp32022-08-11 05:01 0  
[SND]elsakane5.mp32022-08-11 04:59 0  
[SND]HARAM.mp32022-08-11 04:54 1.9M 
[SND]Kobo8.mp32022-08-11 04:48 2.7M 
[SND]Kobo4.mp32022-08-11 04:45 0  
[SND]yy.mp32022-08-11 04:39 3.4M 
[SND]ERIKA1.mp32022-08-11 04:38 0  
[SND]xy.mp32022-08-11 04:37 0  
[SND]xx.mp32022-08-11 04:33 3.3M 
[SND]SEYNONSTOP.mp32022-08-11 04:33 0  
[SND]tw.mp32022-08-11 04:31 0  
[SND]Week 2 Support.mp32022-08-11 04:28 0  
[SND]Week 3 Support.mp32022-08-11 04:28 0  
[SND]Week 4 Support.mp32022-08-11 04:27 1.7M 
[SND]Week 1 Support.mp32022-08-11 04:26 0  
[SND]mgc.mp32022-08-11 04:25 0  
[SND]Sey2.mp32022-08-11 04:25 0  
[SND]Bimbo.mp32022-08-11 04:23 0  
[SND]Rain.mp32022-08-11 04:22 924K 
[SND]KANECOK.mp32022-08-11 04:20 0  
[SND]industry.mp32022-08-11 04:15 0  
[SND]specret.mp32022-08-11 04:14 0  
[SND]Daa.mp32022-08-11 04:11 3.3M 
[SND]KG _ Nik Makino ( Lyrics ).mp32022-08-11 04:11 0  
[SND]y2mate.com - Lil Nas X HOLIDAY Official Video.mp32022-08-11 04:08 0  
[SND]CORRUPTION - 101 OST.mp32022-08-11 04:07 0  
[SND]Високосный Год - Тихий Огонек.mp32022-08-11 04:03 0  
[SND]djviral.mp32022-08-11 04:03 3.8M 
[SND]СИНИЕ ФИАЛКИ - The Limba (1).m4a2022-08-11 04:02 0  
[SND]Sey1.mp32022-08-11 04:02 0  
[SND]Sey5.mp32022-08-11 03:59 0  
[SND]Sey4.mp32022-08-11 03:58 0  
[SND]Sey3.mp32022-08-11 03:58 0  
[SND]walk with me1.mp32022-08-11 03:55 272K 
[SND]Super boom 2019 Dj Ciray Nonstop bass cực phiêu.mp32022-08-11 03:50 0  
[SND]MIGUELA.mp32022-08-11 03:50 0  
[SND]Hbpasyon123.mp32022-08-11 03:46 0  
[SND]happy birthday remix 2021 _ happy birthday to you _ happy birthday techno budots 2021.mp32022-08-11 03:45 0  
[SND]audio.mp32022-08-11 03:42 544K 
[SND]y2mate.com - Lỡ Yêu Người Đậm Sâu Lofi Ver Linh Hương Luz Cánh Hoa tàn tình tan và em bay theo gió ngàn_320kbps.mp32022-08-11 03:42 1.4M 
[SND]funkot.mp32022-08-11 03:40 1.5M 
[SND]BILAL1.mp32022-08-11 03:38 2.9M 
[SND]Kira1123.mp32022-08-11 03:38 0  
[SND]Proyecto TQ - Fuego (OST Сыны анархии 5 сезон).mp32022-08-11 03:36 0  
[SND]y2mate.com - Tương Tư Nan Tuyệt Remix Đại Thần Tuệ Top 10 Bài hát TikTok MỚI NHẤT tuần vừa qua AML MUSIC.mp32022-08-11 03:33 0  
[SND]hbpasyon.mp32022-08-11 03:33 0  
[SND]dj6.mp32022-08-11 03:31 436K 
[SND]HBkira1.mp32022-08-11 03:31 0  
[SND]y2mate.com - Lãng Tử Nhàn Thoại Thiên Tú HM Remix Thái Quỳnh Cover Hot Tiktok 2020.mp32022-08-11 03:24 3.9M 
[SND]Virgoun - Surat Cinta Untuk Starla (Official Lyric Video).mp32022-08-11 03:24 4.2M 
[SND]y2mate.com - Perfect Ed Sheeran Lyrics.mp32022-08-11 03:21 0  
[SND]TIIL I DIE1.mp32022-08-11 03:19 0  
[SND]sanjis01.mp32022-08-11 03:15 0  
[SND]sanji01.mp32022-08-11 03:13 0  
[SND]djkedua.mp32022-08-11 03:11 0  
[SND]kurdhell.mp32022-08-11 03:11 0  
[SND]kedua.mp32022-08-11 03:11 0  
[SND]egk.mp32022-08-11 03:09 0  
[SND]sunami1.mp32022-08-11 03:09 0  
[SND]ygkedua.mp32022-08-11 03:05 0  
[SND](01) [Ray Manzarek] Too Close To The Sun.mp32022-08-11 03:03 0  
[SND]jadikan.mp32022-08-11 03:01 0  
[SND]Badut.mp32022-08-11 02:54 5.8M 
[SND]mcrp.mp32022-08-11 02:53 0  
[SND]Qwerty.mp32022-08-11 02:50 0  
[SND]Smp1.mp32022-08-11 02:47 0  
[SND]345345.mp32022-08-11 02:38 0  
[SND]123123.mp32022-08-11 02:36 0  
[SND]Smile.mp32022-08-11 02:22 0  
[SND]Come.mp32022-08-11 02:17 4.1M 
[SND]Buhay.mp32022-08-11 02:17 0  
[SND]Myself.mp32022-08-11 02:14 0  
[SND]Lorna Shore - To the Hellfire.mp32022-08-11 02:13 444K 
[SND]mrp.mp32022-08-11 02:13 227K 
[SND]jaya.mp32022-08-11 02:10 1.1M 
[SND]05 Montreux Inventions.mp32022-08-11 02:09 1.5M 
[SND](MV) JJJJ - Bung Saranghae (Prod.by บังจะบิน ).mp3.mp32022-08-11 02:06 0  
[SND](MV) JJJJ - Bung Saranghae (Prod.by บังจะบิน ).mp32022-08-11 02:02 0  
[SND]MURDER.mp32022-08-11 01:59 0  
[SND]Har22.mp32022-08-11 01:57 0  
[SND]Har21.mp32022-08-11 01:57 0  
[SND]DODI.mp32022-08-11 01:53 0  
[SND]Makeawishnct.mp32022-08-11 01:47 0  
[SND]Make a wish nct.mp32022-08-11 01:44 0  
[SND]Marko7.mp32022-08-11 01:42 0  
[SND]Marko5.mp32022-08-11 01:42 0  
[SND]Marko3.mp32022-08-11 01:42 0  
[SND]Marko2.mp32022-08-11 01:42 0  
[SND]Marko4.mp32022-08-11 01:42 0  
[SND]Dangdut1.mp32022-08-11 01:40 0  
[SND]KNTL.mp32022-08-11 01:39 1.3M 
[SND]JOKOTINGKIR.mp32022-08-11 01:37 0  
[SND]The Weeknd - Is There Someone Else (Official Audio).mp32022-08-11 01:33 0  
[SND]Die For You.mp32022-08-11 01:33 4.0M 
[SND]YUMMY_7 (2).mp32022-08-11 01:27 0  
[SND]djogi.mp32022-08-11 01:26 0  
[SND]power.mp32022-08-11 01:26 0  
[SND]NCTUMake_A_Wish_Birthday_Song_MV_tyrVtwE8Gv0_140.mp3s.mp32022-08-11 01:26 0  
[SND]morning-with-coffee-loop_GytAO4Eu.mp32022-08-11 01:20 0  
[SND]WhatsApp Audio 2022-08-11 at 08.13.48.mp3s.mp32022-08-11 01:16 340K 
[SND]Jhon14.mp32022-08-11 01:09 0  
[SND]Jhon13.mp32022-08-11 01:08 0  
[SND]lian.mp32022-08-11 01:04 0  
[SND]ADLIN_-_Dead_Inside_73224409.mp32022-08-11 00:59 0  
[SND]Lagi1.mp32022-08-11 00:56 0  
[SND]yt1s.com - Hari ini hari ulang tahunmu Mentahan LirikAesthetic .mp32022-08-11 00:55 0  
[SND]momong.mp32022-08-11 00:50 0  
[SND]pizzapastaputitinabox.mp32022-08-11 00:47 0  
[SND]Phonk10.mp32022-08-11 00:42 0  
[SND]8sec.mp32022-08-11 00:38 0  
[SND]ACDC_-_Back_In_Black_47830042.mp32022-08-11 00:38 892K 
[SND]🎧🎶DJ GOLDEN CROWN BREAKBEAT VIRAL TIKTOK YANG DI CARI!!🎶🎧.mp32022-08-11 00:33 0  
[SND]dj eyes.mp32022-08-11 00:33 0  
[SND]Day89.mp32022-08-11 00:32 0  
[SND]macarena2.mp32022-08-11 00:31 0  
[SND]DJ BASS BETON OLEJON OLEJON X OCOPAKELE PARTY KELUD ALL TALENT NEW REMIX.mp32022-08-11 00:31 0  
[SND]Dj karena kamu dj tiktok terbaru 2021 karena kamu.mp32022-08-11 00:31 0  
[SND]duyz.mp32022-08-11 00:30 0  
[SND]Words30.mp32022-08-11 00:28 0  
[SND]samuel_oayk.mp32022-08-11 00:26 0  
[SND]no.mp32022-08-11 00:21 256K 
[SND]Yeni proje.mp32022-08-11 00:21 0  
[SND]after dark — mr.kitty (lyrics).mp32022-08-11 00:14 0  
[SND]DJ PAPA LIAT AKU BERNYANYI X PAPEPAP REMIX FULLBASS TERBARU.mp32022-08-11 00:14 0  
[SND]Twenty_One_Pilots_x_Stranger_Things_(getmp3.pro).mp32022-08-11 00:14 0  
[SND]Hoy.mp32022-08-11 00:08 0  
[VID]PA.mp42022-08-11 00:06 0  
[SND]LAGU.mp32022-08-10 23:54 0  
[SND]WhatsApp-Ptt-2022-08-10-at-20.38.00.mp32022-08-10 23:44 0  
[SND]Ds39.mp32022-08-10 23:44 0  
[SND]Jokoti.mp32022-08-10 23:30 0  
[SND]Denny Caknan Happy Asmara Yeni Inka Bojo Loro DC Musik.mp32022-08-10 23:27 0  
[SND]nonton.mp32022-08-10 23:27 0  
[SND]DENNY CAKNAN X HAPPY ASMARA - SATRU 2 ( Offical Li.mp32022-08-10 23:26 0  
[SND]yt1s.com - حلمي تحطم واختفى اغنية مؤثرة وجميلة AMV Ahlam song IZZ ft Emy Hetari لا تفوتك.mp32022-08-10 23:13 0  
[SND]B.mp32022-08-10 23:04 550K 
[SND]ЛИТВИНЕНКО - Чёрные птицы.mp32022-08-10 22:58 0  
[SND]nokomen.mp32022-08-10 22:57 0  
[SND]Arturo Mejia Virtual Pros audio.mp32022-08-10 22:55 0  
[SND]dj takkan.mp32022-08-10 22:43 0  
[SND]easy11.mp32022-08-10 22:40 0  
[SND]djsm-robbe-frank-moody 3sec.mp32022-08-10 22:35 0  
[SND]- Sēnes (320kbps) (mp3cut.net).mp32022-08-10 22:29 0  
[SND]Neil Cicierega - Bega Interlude (2).mp32022-08-10 22:27 0  
[SND]Glooco.mp32022-08-10 22:24 3.9M 
[SND]Glouco.mp32022-08-10 22:23 0  
[SND]Sad1.mp32022-08-10 22:20 2.8M 
[SND]Neil Cicierega - Bega Interlude.mp32022-08-10 22:17 0  
[SND]X-WAYNE, SH3TLVIZ - RAMPAGE.mp32022-08-10 22:17 0  
[SND]GnL2.mp32022-08-10 22:14 0  
[SND]GnL1.mp32022-08-10 22:13 0  
[SND]memetj.mp32022-08-10 22:12 0  
[SND]Arabic Nokia Type Beat.mp32022-08-10 22:11 0  
[SND]ROXIE1.mp32022-08-10 22:10 0  
[SND]DEAD_BLONDE_-_Malchik_Na_Devyatke_70892133.mp32022-08-10 22:09 0  
[SND]Miyagi& Эндшпильfeat.Ре.mp32022-08-10 22:07 0  
[SND]SEDIH2.mp32022-08-10 22:06 0  
[SND]Sad5.mp32022-08-10 22:06 0  
[SND]Chepz.mp32022-08-10 22:04 0  
[SND]SAD6.mp32022-08-10 22:02 0  
[SND]ssstik.io_1660161295319 (2).mp32022-08-10 22:00 0  
[SND]ssstik.io_1660161295319.mp32022-08-10 21:59 0  
[SND]Sedih6.mp32022-08-10 21:59 0  
[SND]Delusi.mp32022-08-10 21:56 0  
[SND]DEAD BLONDE - Мальчик на девятке.mp32022-08-10 21:39 8.2M 
[SND]ojoban.mp32022-08-10 21:34 0  
[SND]Vp10.mp32022-08-10 21:30 440K 
[SND]szum.mp32022-08-10 21:30 0  
[SND]Wenaro, Lxner - Лёд.mp32022-08-10 21:30 0  
[SND]den_vau_tong_hop_nhung_bai_hat_hay_nhat_cua_den_vau_2022_2212807356951642854 (1).mp32022-08-10 21:08 0  
[SND]bato bre.mp32022-08-10 20:55 1.2M 
[SND]ss.mp32022-08-10 20:48 66K 
[SND]oh-no-113125.mp32022-08-10 20:48 66K 
[SND]me-hurt-sounds-40085.mp32022-08-10 20:46 401K 
[SND]Drill1.mp32022-08-10 20:46 2.2M 
[SND]Underworld (Slowed + Bass Boosted)@KNRD Music Support Our Second Channel🙏🏻.mp32022-08-10 20:44 5.6M 
[SND]Песня - По блоку катит Phantom мы как всегда на стиле.mp32022-08-10 20:39 5.7M 
[SND]VIP3.mp32022-08-10 20:37 46M 
[SND]VIP2.mp32022-08-10 20:37 25M 
[SND]VIP1.mp32022-08-10 20:36 29M 
[SND]suara pintu.mp32022-08-10 20:35 0  
[SND]Disguise.mp32022-08-10 20:35 0  
[SND]Azer.mp32022-08-10 20:28 0  
[SND]13.mp32022-08-10 20:24 4.1M 
[SND]11.mp32022-08-10 20:23 0  
[SND]srra16.mp32022-08-10 20:22 0  
[SND]thechille.mp32022-08-10 20:22 372K 
[SND]december7.mp32022-08-10 20:17 0  
[SND]y2mate.com - Fell Under a Spell Remix.mp32022-08-10 20:17 0  
[SND]Dhikaa9.mp32022-08-10 20:15 0  
[SND]_DIL_KI_DOYA_HOY_NA__by_Oyshee.mp32022-08-10 20:04 0  
[SND]yerle-yeksan-drill-remix.mp32022-08-10 20:01 0  
[SND]Axepep7.mp32022-08-10 19:57 0  
[SND]jor1.mp32022-08-10 19:55 0  
[SND]memek1.mp32022-08-10 19:54 0  
[SND]Blood Upon the Risers -Gory Gory What a Hell of a Way to Die-.mp32022-08-10 19:52 0  
[SND]xcho_ty-i-ya.mp32022-08-10 19:50 0  
[SND]TAWA.mp32022-08-10 19:50 0  
[SND]pure-n-a-cnv-sound-vol-14-file.mp32022-08-10 19:48 0  
[SND]❄🍷Andreyka rmx🍷❄-🚫хуй с ним🚫-kissvk.com.mp32022-08-10 19:45 796K 
[SND]on the floor.mp32022-08-10 19:45 0  
[SND]AjiMat65.mp32022-08-10 19:45 0  
[SND]y2mate.com - MONSTER MASH.mp32022-08-10 19:41 0  
[SND]gromkaya_sirena_na_zvonok_telefona.mp32022-08-10 19:40 0  
[SND]Tabii.mp32022-08-10 19:38 0  
[SND]BalainDo5.mp32022-08-10 19:33 0  
[SND]B5.mp32022-08-10 19:27 3.6M 
[SND]vasco20.mp32022-08-10 19:25 0  
[SND]hatiku.mp32022-08-10 19:23 0  
[SND]Lucy2.mp32022-08-10 19:22 0  
[SND]Sgt3.MP.mp32022-08-10 19:22 0  
[SND]vektor-a-lyudi-mp3.mp32022-08-10 19:22 0  
[SND]Good1.mp32022-08-10 19:22 0  
[SND]PETRUNSKO_BY_FAN_ONE_BASS_BOOSTE_(getmp3.pro).mp32022-08-10 19:19 0  
[SND]Lil_Morty_-_FLEXING_FINESSING.mp32022-08-10 19:15 0  
[SND]Вектор А-Люди-kissvk.com.mp32022-08-10 19:13 0  
[SND]Get Get Down (Bass + Pitched down).mp32022-08-10 19:03 0  
[SND]the new sweet groove.mp32022-08-10 19:01 0  
[SND]ozzy.mp32022-08-10 18:57 0  
[SND]John15.mp32022-08-10 18:57 0  
[SND]1542027632_miyagi_-_rodnaya_poi_feat__kadi_muzonov_net.mp32022-08-10 18:57 0  
[SND]XXXTENTACION - Revenge (slowed & reverb)_.mp32022-08-10 18:56 0  
[SND]faceit sound.mp32022-08-10 18:52 0  
[SND]Nba YoungBoy - Chopper City.mp32022-08-10 18:51 0  
[SND]NBA YoungBoy -No Switch (music video).mp32022-08-10 18:51 0  
[SND]rb.mp32022-08-10 18:50 0  
[SND]John125.mp32022-08-10 18:50 0  
[SND]quiizzzmeow_-_Aomine_Daiki_(musmore.com).mp32022-08-10 18:47 0  
[SND][lagu1s.com]Angel Baby - Troye Sivan.aZX2BoxbUdk.mp32022-08-10 18:45 2.0M 
[SND]hhh.mp32022-08-10 18:43 0  
[SND]req.mp32022-08-10 18:41 0  
[SND]yanto02.mp32022-08-10 18:40 0  
[SND]yanto01.mp32022-08-10 18:39 0  
[SND]ধুলাবালি,_Dhulabali_by_Ashes_lyrics._Unofficial_video_song.mp32022-08-10 18:34 0  
[SND]Troye-Sivan-Angel-Baby-Lyrics_UsBOJRIAwZo.mp32022-08-10 18:33 192K 
[SND]jen.mp32022-08-10 18:22 0  
[SND]TO KILL A GOD Epic Battle Dark Heroic Music Epic Music Mix by @Audiomachine.mp32022-08-10 18:16 0  
[SND]YNV.mp32022-08-10 18:11 0  
[SND]Мельница - Бес Джиги.mp32022-08-10 18:11 2.3M 
[SND]zatyanu.mp32022-08-10 18:09 0  
[SND]22.mp32022-08-10 18:06 1.0M 
[SND]joby3.mp32022-08-10 18:04 0  
[SND]joby1.mp32022-08-10 18:04 156K 
[SND]joby2.mp32022-08-10 18:04 0  
[SND]verbee-odin-mp3-1.mp32022-08-10 17:56 0  
[SND]beograd-official-video.mp32022-08-10 17:55 0  
[SND]Masked Wolf - Pandemonium (Official Video).mp32022-08-10 17:54 0  
[SND]videoplayback.mp32022-08-10 17:54 2.4M 
[SND]BoyWithUke - Toxic.mp32022-08-10 17:53 0  
[SND]Zatyany.mp32022-08-10 17:53 0  
[SND]asitwas .mp32022-08-10 17:53 2.5M 
[SND]Waterflame - Swirl! (Chip-tune Remix).mp32022-08-10 17:53 0  
[SND]Travis_Scott_-_SICKO_MODE_ft._Drake(256k).mp32022-08-10 17:52 0  
[SND]♚💔🎲LADA PRIORA 2007🎲💔♚ - Затяну шнурки потуже подойди же что ты ну же.mp32022-08-10 17:52 0  
[SND]ck02.mp32022-08-10 17:50 0  
[SND]Rhove - Shakerando (prod. Voluptyk) (TestoLyrics) (mp3cut.net).mp32022-08-10 17:49 0  
[SND]Shadowraze - showdown.mp32022-08-10 17:44 0  
[SND]УННВ - Без даты (Remix) (Remix).mp32022-08-10 17:44 36K 
[SND]Shadowraze - shadowfiend.mp32022-08-10 17:44 5.5M 
[SND]Shadowraze - astral step.mp32022-08-10 17:44 4.6M 
[SND]ba9a.mp32022-08-10 17:44 0  
[SND]Christina_Perri_-_A_Thousand_Years_[Official_Music_Video](256k).mp32022-08-10 17:43 0  
[SND]dgsdg.mp32022-08-10 17:42 0  
[SND]6feet.mp32022-08-10 17:39 0  
[SND]atldance.mp32022-08-10 17:39 0  
[SND]scarlxrd6feet.mp32022-08-10 17:38 0  
[SND]Fly Me to the Moon (Acoustic).mp32022-08-10 17:38 0  
[SND]rider11.mp32022-08-10 17:36 0  
[SND]Ba9a Ft Gharmoul - Mkarez (official music video)[Mpgun.com].mp32022-08-10 17:35 0  
[SND]c.mp32022-08-10 17:34 136K 
[SND]H8.HOOD - PHANTOM.mp32022-08-10 17:32 0  
[SND]Oxtan2.mp32022-08-10 17:30 0  
[SND]sad1.mp32022-08-10 17:26 3.1M 
[SND]YAd_Dobra_-_Vremya_molodjozhi_68701792.mp32022-08-10 17:25 0  
[SND]sad2.mp32022-08-10 17:25 1.8M 
[SND]Vacation.mp32022-08-10 17:25 0  
[SND]roberry.mp32022-08-10 17:24 0  
[SND]m.mp32022-08-10 17:22 2.8M 
[SND]pink1.mp32022-08-10 17:21 0  
[SND]Султан Лагучев - Любовь беда (Miro's Remix).mp32022-08-10 17:19 0  
[SND]ck12.mp32022-08-10 17:18 0  
[SND]iwgd.mp3.mp32022-08-10 17:17 0  
[SND]Hell March (Remastered).mp32022-08-10 17:16 0  
[SND]sad Dx.mp32022-08-10 17:15 0  
[SND]abin.mp32022-08-10 17:15 0  
[SND]Oxtan1.mp32022-08-10 17:13 0  
[SND]y2mate.com - Arctic Monkeys Snap Out Of It Official Audio.mp32022-08-10 17:08 0  
[SND]ckrider1.mp32022-08-10 17:07 0  
[SND]s1.mp32022-08-10 17:07 340K 
[SND]Gospozha_Kaguya_v_lyubvi_kak_na_vojne_-_2_sezon_Opening_(iPleer.com).mp32022-08-10 17:04 3.4M 
[SND]BlueWednesday.mp32022-08-10 17:02 2.7M 
[SND]Maprider1.mp32022-08-10 16:56 0  
[SND]ck1.mp3.mp32022-08-10 16:51 0  
[SND]ck2.mp3.mp32022-08-10 16:50 0  
[SND]m.m4a2022-08-10 16:49 0  
[SND]maprideralle.mp32022-08-10 16:47 0  
[SND]munni.mp32022-08-10 16:47 0  
[SND]maprider.mp32022-08-10 16:46 0  
[SND]viral.mp32022-08-10 16:46 3.4M 
[SND]perang.mp32022-08-10 16:46 1.2M 
[SND]ms13.mp32022-08-10 16:46 2.0M 
[SND]king.mp32022-08-10 16:46 3.0M 
[SND]Wala.mp3.mp32022-08-10 16:45 0  
[SND]trim.09E25743-B1D4-4D53-ABE4-5B8CA3057D2E.mp32022-08-10 16:43 0  
[SND]Wala.mp32022-08-10 16:43 0  
[SND]zill100.mp32022-08-10 16:42 0  
[SND]chinwa probleme...عطوني..شيشة.. نطلع(MP3_320K).mp32022-08-10 16:37 3.4M 
[SND]ck09.mp32022-08-10 16:32 11M 
[VID]Night.mp42022-08-10 16:32 12M 
[SND]Maskoff.mp32022-08-10 16:29 1.7M 
[SND]Chiddy-Bang-Old-Ways.mp32022-08-10 16:28 0  
[SND]Hang.mp32022-08-10 16:25 0  
[SND]vaar.mp32022-08-10 16:16 0  
[SND]Sancey.mp32022-08-10 16:15 0  
[SND]zacky4.mp32022-08-10 16:08 0  
[SND]purge.mp32022-08-10 16:02 0  
[SND]pp.mp32022-08-10 16:02 3.2M 
[SND]S7.mp32022-08-10 15:56 2.4M 
[SND]MALA - MORO FT PROFIT ZA3IM - STOOR - WEST ( VIDEO ANIMATION )(MP3_320K).mp32022-08-10 15:48 0  
[SND]MT.mp32022-08-10 15:28 0  
[SND]Swagging13.mp32022-08-10 15:25 0  
[SND]Adfi.mp32022-08-10 15:23 0  
[SND]KG.mp32022-08-10 15:22 1.7M 
[SND]Misaki.mp32022-08-10 15:22 2.1M 
[SND]Best.mp32022-08-10 15:20 0  
[SND]tnh.mp32022-08-10 15:19 0  
[SND]kyh.mp32022-08-10 15:19 0  
[SND]dibui.mp32022-08-10 15:18 0  
[SND]xipo.mp32022-08-10 15:18 0  
[SND]Thank you-ify jones.mp32022-08-10 15:15 0  
[SND]SADOP.mp32022-08-10 15:15 1.4M 
[SND]siren.mp32022-08-10 15:15 6.9K 
[SND]Charlie Pryce - Summer Sounds Vol 3.mp32022-08-10 15:11 0  
[SND]Muli.mp32022-08-10 15:11 4.4M 
[SND]Minesr.mp32022-08-10 15:10 0  
[SND]Ace Banzuelo - Muli (Lyrics).mp32022-08-10 15:09 4.4M 
[SND]a3.mp32022-08-10 15:08 1.9M 
[SND]Bitch.mp32022-08-10 15:02 0  
[SND]BooM1.mp32022-08-10 14:56 348K 
[SND]bgmusic.mp32022-08-10 14:56 1.7M 
[SND]vikramgirl.mp32022-08-10 14:53 0  
[SND]DJSAD.mp32022-08-10 14:50 536K 
[SND]Vp13.mp32022-08-10 14:49 2.3M 
[SND]top.mp32022-08-10 14:48 3.1M 
[SND]arcade.mp32022-08-10 14:47 3.9M 
[SND]Maki.mp32022-08-10 14:25 3.5M 
[SND]sateboy.mp32022-08-10 14:09 0  
[SND]Кореш - глаза не врут.mp32022-08-10 14:08 0  
[SND]Eminem & 2Pac - Björn Ironside VS Ivar The Boneless (2019).mp32022-08-10 14:07 0  
[SND]y2mate.com - no copyright music Purple lofi background music_256kbps.mp32022-08-10 14:05 0  
[SND]mmm.mp32022-08-10 14:04 2.2M 
[SND]Thai3.mp32022-08-10 14:04 0  
[SND]Anees.mp32022-08-10 14:04 2.4M 
[SND]Ayana2.mp32022-08-10 14:02 0  
[SND]Le rêve - Chococlub.mp32022-08-10 14:02 0  
[SND]Nm1.mp32022-08-10 14:02 2.6M 
[SND]Hajib - Ezzin ( Medi Remix )(MP3_70K).mp32022-08-10 14:00 0  
[SND]orgenlampung.mp32022-08-10 13:59 0  
[SND]HatdogManila.mp32022-08-10 13:59 0  
[SND]L.mp32022-08-10 13:57 1.9M 
[SND]wow.mp32022-08-10 13:55 2.1M 
[SND]Vp21.mp32022-08-10 13:54 1.2M 
[SND]Vp20.mp32022-08-10 13:54 2.5M 
[SND]Vp19.mp32022-08-10 13:54 0  
[SND]Sateboy.mp32022-08-10 13:54 1.3M 
[SND]Morshu_beatbox_loop_(getmp3.pro).mp32022-08-10 13:53 0  
[SND]nhachay.mp32022-08-10 13:51 0  
[SND]relod.mp32022-08-10 13:49 256K 
[SND]makna puasa.mp32022-08-10 13:49 0  
[SND]Bongga.mp32022-08-10 13:49 0  
[SND]RandaHalal.mp32022-08-10 13:45 0  
[SND]Lagukuu.mp32022-08-10 13:45 0  
[SND][YT2mp3.info] - Unconditionally X Dandelions (Lyrics) Slowed Version (320kbps).mp32022-08-10 13:42 0  
[SND]Dancingqueen.mp32022-08-10 13:41 0  
[SND]Jamik_-_samoljotkarmv_rmx_(musportal.org).mp32022-08-10 13:39 0  
[SND]På Topp Final.mp32022-08-10 13:39 0  
[SND]Dacingqueen.mp32022-08-10 13:37 0  
[SND]mp12.mp32022-08-10 13:36 3.7M 
[SND]VinKy11.mp32022-08-10 13:34 3.0M 
[SND]RE.mp32022-08-10 13:31 2.9M 
[SND]HD.mp32022-08-10 13:28 0  
[SND]awitin.mp32022-08-10 13:28 696K 
[SND]AUD-20220605-WA0030.mp32022-08-10 13:26 617K 
[SND]mp11.mp32022-08-10 13:26 3.3M 
[SND]AUD-20220406-WA0026.mp32022-08-10 13:25 112K 
[SND]lk.mp32022-08-10 13:24 199K 
[SND]ASl.mp32022-08-10 13:24 0  
[SND]kl.mp32022-08-10 13:23 0  
[SND]huy1234.mp32022-08-10 13:21 0  
[SND]jh.mp32022-08-10 13:20 0  
[SND]Абрикоса - Влюбилась В Друга.mp32022-08-10 13:19 0  
[SND]หูไม่ตรงกับตา (2).mp32022-08-10 13:16 0  
[SND]DrawinCopyRight.mp32022-08-10 13:16 0  
[SND]HJ.mp32022-08-10 13:15 3.4M 
[SND]va7.mp32022-08-10 13:11 0  
[SND]hg3.mp32022-08-10 13:10 0  
[SND]AT40 01-23-1982 #1.mp32022-08-10 13:06 0  
[SND]y2mate.com - DJ SIKOK BAGI DUO REMIX PALEMBANG JEDAG JEDUG MENGKANE VIRAL TIKTOK_2.mp32022-08-10 13:03 0  
[SND]Heart of Courage.mp32022-08-10 12:58 2.7M 
[SND]freelofi.mp32022-08-10 12:54 0  
[SND]Joji - Glimpse Of Us.mp32022-08-10 12:53 0  
[SND]yan29.mp32022-08-10 12:53 0  
[SND]yan25.mp32022-08-10 12:53 0  
[SND]yan24.mp32022-08-10 12:53 0  
[SND]yan23.mp32022-08-10 12:53 0  
[SND]yan28.mp32022-08-10 12:53 0  
[SND]y2mate.com - DJ HANING SING PUSING MUKA KAYA KINGKONG.mp32022-08-10 12:53 0  
[SND]yan27.mp32022-08-10 12:52 0  
[SND]yan26.mp32022-08-10 12:52 0  
[SND]janji1.mp32022-08-10 12:49 632K 
[SND]Fellixs3.mp32022-08-10 12:49 0  
[SND]Fellixs2.mp32022-08-10 12:48 0  
[SND]A7.mp32022-08-10 12:47 0  
[SND]Untitled.mp32022-08-10 12:47 0  
[SND]Fellixs1.mp32022-08-10 12:47 0  
[SND]Dilemma.mp32022-08-10 12:44 0  
[SND]seto1.mp32022-08-10 12:43 0  
[SND]The Weeknd - Blinding Lights (Lyrics) (1).mp32022-08-10 12:42 0  
[SND]Diviners.mp32022-08-10 12:40 0  
[SND]A6.mp32022-08-10 12:36 2.8M 
[SND]Vp18.mp32022-08-10 12:35 0  
[SND]Vp17.mp32022-08-10 12:35 1.6M 
[SND]Vp16.mp32022-08-10 12:35 3.0M 
[SND]Vp15.mp32022-08-10 12:35 3.8M 
[SND]Vp14.mp32022-08-10 12:35 3.2M 
[SND]kzsquat.mp32022-08-10 12:35 0  
[SND]y2mate.com - DJ DOMINO MAROKO TANGKIS DANG TIIKTOK VIRAL 2022.mp32022-08-10 12:34 0  
[SND]FSD.mp32022-08-10 12:33 852K 
[SND]jo.mp32022-08-10 12:33 3.2M 
[SND]Blights.mp32022-08-10 12:32 0  
[SND]jk.mp32022-08-10 12:32 0  
[SND]KontolX1.mp32022-08-10 12:32 0  
[SND]MORI.mp32022-08-10 12:29 0  
[SND]Rahmat XxX1.mp32022-08-10 12:28 0  
[SND]yt1s.com - living life in the night ringtonewhatsapp status PABLO BEATS.mp32022-08-10 12:28 0  
[SND]ModeM_-_V_rukakh_avtomat.mp32022-08-10 12:20 0  
[SND]haning.mp32022-08-10 12:19 0  
[SND]lampung.mp32022-08-10 12:19 0  
[SND]basco sellout.mp32022-08-10 12:17 0  
[SND]Anas4.mp32022-08-10 12:17 0  
[SND]Anas3.mp32022-08-10 12:16 0  
[SND]Marcus_-_Senorita_66243016.mp32022-08-10 12:12 0  
[SND]LeonskyXXX1.mp32022-08-10 12:11 0  
[SND]Asw.mp32022-08-10 12:11 4.3M 
[SND]Jancokk.mp32022-08-10 12:09 0  
[SND]altjbreezeblocks.mp32022-08-10 12:09 0  
[SND]LeonskyXXX.mp32022-08-10 12:04 0  
[SND]joji.mp32022-08-10 12:04 2.7M 
[SND]_Allen_GAMMATEP X LilAiNidd.mp32022-08-10 12:03 2.2M 
[SND]lcrpbinibini.mp32022-08-10 12:00 144K 
[SND]strong.mp32022-08-10 11:59 2.4M 
[SND]sedaya.mp32022-08-10 11:58 0  
[SND]yan9.mp32022-08-10 11:58 5.4M 
[SND]yan6.mp32022-08-10 11:58 8.0M 
[SND]yan8.mp32022-08-10 11:57 3.7M 
[SND]yan7.mp32022-08-10 11:57 4.2M 
[SND]yan3.mp32022-08-10 11:57 5.3M 
[SND]Keep You Safe Yahya.mp32022-08-10 11:57 0  
[SND]yan5.mp32022-08-10 11:57 1.9M 
[SND]yan4.mp32022-08-10 11:57 4.8M 
[SND]yan21.mp32022-08-10 11:56 5.5M 
[SND]yan22.mp32022-08-10 11:56 7.9M 
[SND]yan20.mp32022-08-10 11:56 5.4M 
[SND]yan2.mp32022-08-10 11:56 4.9M 
[SND]yan13.mp32022-08-10 11:56 7.1M 
[SND]yan19.mp32022-08-10 11:55 4.8M 
[SND]yan15.mp32022-08-10 11:55 5.3M 
[SND]yan18.mp32022-08-10 11:55 2.2M 
[SND]yan16.mp32022-08-10 11:55 3.6M 
[SND]yan14.mp32022-08-10 11:55 3.4M 
[SND]yan17.mp32022-08-10 11:55 2.4M 
[SND]yan12.mp32022-08-10 11:55 5.8M 
[SND]yan01.mp32022-08-10 11:55 6.0M 
[SND]yan11.mp32022-08-10 11:55 2.8M 
[SND]yan10.mp32022-08-10 11:55 3.8M 
[SND]yan1.mp32022-08-10 11:54 3.6M 
[SND]yan000.mp32022-08-10 11:54 3.2M 
[SND]yan00.mp32022-08-10 11:54 3.2M 
[SND]yan0.mp32022-08-10 11:54 4.6M 
[SND]Phonk7.mp32022-08-10 11:54 1.1M 
[SND]toge0.mp32022-08-10 11:54 0  
[SND][lagu1s.com]DJ RINDU SEMALAM REMIX VIRAL TIKTOK TERBARU 2022 SEMALAM KU TAHAN KU TAHAN SEMALAM.HoPh8FM0h_E.mp32022-08-10 11:54 0  
[SND]Phonk6.mp32022-08-10 11:54 2.1M 
[SND]Miyagi_JEndshpil_-_BadaBum_70693181.mp32022-08-10 11:54 0  
[SND]Phonk9.mp32022-08-10 11:54 1.8M 
[SND]lcrpmahika.mp32022-08-10 11:54 380K 
[SND]Phonk8.mp32022-08-10 11:54 1.8M 
[SND]Phonk5.mp32022-08-10 11:53 2.2M 
[SND]Phonk4.mp32022-08-10 11:53 1.8M 
[SND]Phonk3.mp32022-08-10 11:53 1.9M 
[SND]Alt-J () _ Breezeblocks Lyrics (HQ).mp32022-08-10 11:53 0  
[SND]𝕐𝒫𝒜人Ѣ𝓒𝓀𝖀𝕌-† - Блатная походка бандит 🍷-kissvk.com.mp32022-08-10 11:52 0  
[SND]rep.mp32022-08-10 11:50 0  
[SND]Phonk2.mp32022-08-10 11:49 2.0M 
[SND]onlymp3.to - Alt-J (∆) _ Breezeblocks Lyrics (HQ)-kT6pFsVA6hA-192k-1660040896941.mp32022-08-10 11:48 652K 
[SND]Phonk1.mp32022-08-10 11:47 1.3M 
[SND]Uta1.mp32022-08-10 11:47 0  
[SND]TOTTO69.mp32022-08-10 11:47 11M 
[SND]TOTTO61.mp32022-08-10 11:47 6.3M 
[SND]TOTTO67.mp32022-08-10 11:47 4.8M 
[SND]DUKH1.mp32022-08-10 11:47 0  
[SND]TOTTO68.mp32022-08-10 11:47 9.7M 
[SND]TTA2.mp32022-08-10 11:47 0  
[SND]SAD2.mp32022-08-10 11:47 0  
[SND]TOTTO70.mp32022-08-10 11:47 8.8M 
[SND]TTA1.mp32022-08-10 11:47 0  
[SND]TOTTO72.mp32022-08-10 11:47 3.2M 
[SND]TOTTO71.mp32022-08-10 11:47 3.3M 
[SND]TOTTO80.mp32022-08-10 11:47 0  
[SND]VANIX.mp32022-08-10 11:47 0  
[SND]sw8.mp32022-08-10 11:46 0  
[SND]sw7.mp32022-08-10 11:45 0  
[SND]sw5.mp32022-08-10 11:45 0  
[SND]sw6.mp32022-08-10 11:45 0  
[SND]Mentahan ccp 30 detik lirik DJ Darkside by alan Walker.mp32022-08-10 11:44 0  
[SND]Ply2.mp32022-08-10 11:44 0  
[SND]𝙙𝙧c3.mp32022-08-10 11:44 0  
[SND]sw4.mp32022-08-10 11:44 0  
[SND]Harble-БЕН x Daycare Theme -FNAF Security Breach OST--kissvk.com.mp32022-08-10 11:43 0  
[SND]alok1.mp32022-08-10 11:42 213K 
[SND]Playboi.mp32022-08-10 11:41 0  
[SND]𝙙𝙧4𝙘𝙤.mp32022-08-10 11:40 0  
[SND]🥀💉Stetex💉🥀-🌪️niko and the niners🌪️-kissvk.com.mp32022-08-10 11:40 0  
[SND]—ʀ ᴀ s т ᴀ ғ ᴀ ʀ ɪ 🌴-Я знаю ты долеко - RMX --kissvk.com.mp32022-08-10 11:39 0  
[SND]🔊💣😈Iliusha🔊💣😈-🌴𝕃𝔼𝕊𝕋𝔻𝕌𝕀𝕋🌴-kissvk.com.mp32022-08-10 11:38 0  
[SND]derevna.mp32022-08-10 11:37 0  
[VID]f9336b6ba13bc84e1892b24f69375c5e.mp42022-08-10 11:37 0  
[SND]y2meta.com - DJ Dash Uciha Plis Ku Tak Suka Preman Slow Tik Tok Remix Terbaru 2021 (DJ Cantik Remix) (320 kbps).mp32022-08-10 11:37 0  
[VID]Video-xin-vinh-biet-cu-www_tiengdong_com.mp42022-08-10 11:36 0  
[SND]bro hayuk mabar bro.mp32022-08-10 11:35 0  
[SND]smsa.mp32022-08-10 11:33 0  
[SND]𝙙𝙧4𝙘𝙤 - 𝙛𝙧𝙖𝙢𝙚𝙙「 𝙨𝙥𝙚𝙙 𝙪𝙥 」.mp32022-08-10 11:29 0  
[SND]herbaltea.mp32022-08-10 11:29 0  
[SND]1657269509300_track.mp32022-08-10 11:27 0  
[SND]Francesco Sartori & Sir James Galway - Time To Say Goodbye (megasongs.me).mp32022-08-10 11:25 0  
[SND]vipusk.mp3.mp32022-08-10 11:25 0  
[SND]snobbism.mp32022-08-10 11:24 0  
[SND]KK.mp32022-08-10 11:24 1.2M 
[SND]TikTok.mp32022-08-10 11:23 5.0M 
[SND]konfuz-kajf-ty-pojmala-alexei-shkurko-remix-mp3.mp32022-08-10 11:20 0  
[SND]25-meiko.mp32022-08-10 11:20 0  
[SND]LIZER_Moi_ruki_ne_krylya_da_i_lyudi_ne_pticy.mp32022-08-10 11:20 0  
[SND]alex-andreev-gip-y-prince-padal-belyj-sneg.mp32022-08-10 11:20 0  
[SND]Ислам Итляшев - Ой ой ой сердце думай головой (mp3day.net).mp32022-08-10 11:20 0  
[SND]KIRYA_NASVAEV_-_MATIZ_nightcore_bassboost_74153549.mp32022-08-10 11:19 0  
[SND]ck.mp3.mp32022-08-10 11:18 888K 
[SND]Zx.mp32022-08-10 11:16 0  
[SND]HerbalTea.mp32022-08-10 11:15 0  
[SND]_Salahkah kita_-robinhood ft asmirandah..mp32022-08-10 11:14 0  
[SND]paa.mp3.mp32022-08-10 11:13 0  
[SND]Ariel.mp32022-08-10 11:11 0  
[SND]Paa Sa Lupa Pilyo Gang Ft JCF.mp32022-08-10 11:10 0  
[SND]ཌ乂卂爪乇尺ད - 𝐒𝐍𝐎𝐖.mp32022-08-10 11:08 0  
[VID]5efada2250010dd06d5bfc8448fedfbc.mp42022-08-10 11:07 0  
[SND]GAYAZOV$ BROTHER$ - СИНИЙ ИНЕЙ.mp32022-08-10 11:04 0  
[SND]sktzxx.mp32022-08-10 11:03 0  
[SND]TUG.mp32022-08-10 11:00 0  
[VID]8e178bc25390c1107022f148bb786f2e.mp42022-08-10 10:59 0  
[SND]lkdj.mp32022-08-10 10:55 0  
[SND]Üsma.m4a2022-08-10 10:48 0  
[SND]MATRANG - ПАТРИАРХАТ (1).mp32022-08-10 10:48 848K 
[SND]Vip4.mp32022-08-10 10:48 3.8M 
[SND]ilham10.mp32022-08-10 10:47 2.8M 
[SND]Masteran 1 jam untuk murai batu isian lengkap.mp32022-08-10 10:45 0  
[SND]ลลา นกบนหลาดง White-rumped shama Display.mp32022-08-10 10:44 452K 
[SND]BUDOTS.mp32022-08-10 10:44 15M 
[SND]Suara pikat burung sertu 100 ampuh!!! Dan memancing sertu yg macet bunyi.mp32022-08-10 10:44 0  
[SND]Masteran Favorit Murai Batu Suara Burung 3 In 1. Tengkek Buto, Cililin, Kapas Tembak.mp32022-08-10 10:44 0  
[SND]sw3.mp32022-08-10 10:43 0  
[SND]ChuChu TV Baby Shark - Good Habits and Many More Videos Popular Nursery Rhymes Collection.mp32022-08-10 10:43 0  
[SND]Ne2.mp32022-08-10 10:42 0  
[SND]Suara burung cipohsirtu cocok buat mancing jantan.mp32022-08-10 10:42 0  
[SND]Johny Johny Yes Papa Ball Pit Show - ChuChu TV 3D Baby Songs & Nursery Rhymes for Kids.mp32022-08-10 10:42 0  
[SND]sw2.mp32022-08-10 10:42 0  
[SND]Baby goes to Old MacDonalds Farm + More ChuChu TV Baby Nursery Rhymes & Kids Songs.mp32022-08-10 10:41 0  
[SND]10AGE_-_Malyshka_74140548.mp32022-08-10 10:41 0  
[SND]Baby's Humpty Dumpty Song + More ChuChu TV Baby Nursery Rhymes & Kids Songs.mp32022-08-10 10:40 0  
[SND]Andery_Toronto_Diman_Bryukhanov_-_Karavan_73442350.mp32022-08-10 10:40 0  
[SND]Pat a Cake + Many more Nursery Rhymes &amp Kids Songs - ChuChu TV LIVE.mp32022-08-10 10:40 0  
[SND]Happy Kid's Cartoon Music Background.mp32022-08-10 10:39 0  
[SND]Funny Kids Children's Music (Instrumental Music For Kids).mp32022-08-10 10:39 0  
[SND]Cute Background Music for Videos - Cute Little Tikes Kids Song by Happy Face Music.mp32022-08-10 10:39 0  
[SND]ChuChu TV Classics - Let's Learn The Colors! Nursery Rhymes and Kids Songs.mp32022-08-10 10:39 0  
[SND]Bath Song 2 + More ChuChu TV Baby Nursery Rhymes & Kids Songs.mp32022-08-10 10:39 0  
[SND]ChuChu TV Classics - Head Shoulders Knees & Toes Dance Song Nursery Rhymes and Kids Songs.mp32022-08-10 10:38 0  
[SND]Soft Relaxing Baby Sleep Music Best Bedtime Lullabies For Toddlers Good Night Sweet Dreams.mp32022-08-10 10:38 0  
[SND]Lullabies For Kids - Sleep Baby Nursery Rhymes and Kids Songs Baby Songs Little Baby Bum.mp32022-08-10 10:37 0  
[SND]k5Ax.mp32022-08-10 10:37 1.1M 
[SND]DJ-Sikok-Bagi-Duo-Tik-Tok-Remix-Terbaru-2022-DJ-Cantik-Remix_a3cS7dQCKGI.mp32022-08-10 10:36 0  
[SND]Bath Song 2 - ChuChu TV Nursery Rhymes & Kids Songs.mp32022-08-10 10:36 0  
[SND]Siti Nurhaliza - Aisyah Istri Rasulullah ( Cover ).mp32022-08-10 10:35 0  
[SND]SABYAN - AISYAH ISTRI RASULULLAHCOVER.mp32022-08-10 10:35 0  
[SND]AISYAH ISTRI RASULULLAH - ANISA RAHMAN (Cover).mp32022-08-10 10:35 0  
[SND]Aisyah Istri Rasulullah (cover by Sheryl Shazwanie).mp32022-08-10 10:35 0  
[SND]AISYAH ISTRI RASULULLAH - PUTIH ABU ABU COVER.mp32022-08-10 10:35 0  
[SND]AISYAH ISTRI RASULULLAH COVER BY BABY SHIMA.mp32022-08-10 10:34 0  
[SND]Aisyah Istri Rasulullah versi Upin Ipin Terbaru 2020.mp32022-08-10 10:34 0  
[SND]ash.mp32022-08-10 10:33 3.3M 
[SND]Ne3.mp32022-08-10 10:32 0  
[VID]Vp7.mp42022-08-10 10:21 0  
[SND]Tokyo Drift (Fast & Furious).mp32022-08-10 10:16 564K 
[SND]Dajj.mp32022-08-10 10:14 0  
[SND]dejj.mp32022-08-10 10:14 0  
[SND]Manifest.mp32022-08-10 10:12 3.4M 
[SND]Mr. Bill Collector.m4a2022-08-10 10:11 0  
[SND]luckydj.mp32022-08-10 10:09 0  
[SND]MORGENSHTERN, The Limba, NILETTO, Boombl4 - СКОЛЬКО СТОИТ ЛЮБОВЬ.mp32022-08-10 10:05 0  
[SND]NIGHTMORSS - SECRET.mp32022-08-10 10:05 0  
[SND]MORGENSHTERN - Домой.mp32022-08-10 10:05 0  
[SND]Surf Curse - Freaks (Slowed Down).mp32022-08-10 10:05 0  
[SND]Kordhell - Scopin.mp32022-08-10 10:05 3.9M 
[SND]ЯМАУГЛИ - ТАРАНТИНО.mp32022-08-10 10:05 0  
[SND]Cyrus312 - Horny nigga detected.mp32022-08-10 10:05 0  
[SND]Kaito Shoma - konfuz x kaito.mp32022-08-10 10:05 0  
[SND]Maulana-Ardiansyah-Dermaga-Biru-Live-Ska-Reggae_Og6_0laepzM.mp32022-08-10 10:03 0  
[SND]DERMAGA-BIRU-Thomas-Arya-Cover-Sasa-Official_eXPdhMDKHFY.mp32022-08-10 10:03 0  
[SND]Dermaga-Biru-Thomas-Arya-cover-Literasi-60-Detik-by-AA-Kacif_Va1F0ydiHoI.mp32022-08-10 10:03 0  
[SND]Vikram - Rolex BGM.mp32022-08-10 10:00 0  
[SND]Get Out Of My Way - KGF 2 ! Remix.mp32022-08-10 10:00 0  
[SND]Chirakukal-Mulakkuvan(PagalWorld).mp32022-08-10 10:00 0  
[SND]chekuthan_kalame_poyidam.mp32022-08-10 10:00 0  
[SND]Kaadhal-En-Kaviye-MassTamilan.dev.mp32022-08-10 09:59 0  
[SND]y2mate.com - Suzume no Tojimari.mp32022-08-10 09:58 0  
[SND]rafy-glaza-mp3 (1).mp32022-08-10 09:56 0  
[SND]ENZO MF - BANDO feat. Nateman (Official Music Video).mp32022-08-10 09:56 0  
[SND]gsuqkxj.mp32022-08-10 09:54 0  
[SND]X2Download.app - បទថ្មីកំពុងល្បីក្នុង Tik tok 🎬🎼 New Songs by Chan Studio 🎬🎶🎞️ (128 kbps).mp32022-08-10 09:53 0  
[SND]carlruploadmusic1.mp32022-08-10 09:53 0  
[SND]Y2Mate.is - Thundercat - 'Tron Song'-XYGEEa4Qcis-160k-1660125036692.mp32022-08-10 09:50 0  
[SND]get.mp32022-08-10 09:48 0  
[SND]loveann.mp32022-08-10 09:48 0  
[SND]WSHL.mp32022-08-10 09:44 0  
[SND]DCM.mp32022-08-10 09:43 0  
[SND]HAPPY.mp32022-08-10 09:42 3.0M 
[SND]Макс Корж - Малиновый закат.mp32022-08-10 09:42 0  
[SND]DSAAC.mp32022-08-10 09:40 0  
[SND]Slava_-_YA_i_ty_52551041.mp32022-08-10 09:36 0  
[SND]SION Rework Voce Italiana -SION Rework Voice ITA 2014 (mp3cut.net).m4a2022-08-10 09:36 0  
[SND]mp50.mp32022-08-10 09:34 0  
[SND]ken.mp32022-08-10 09:34 0  
[SND]Troye.m4a2022-08-10 09:31 0  
[SND]SUPIAR OTO - D'ROC'K (Official Music Video) (1).mp32022-08-10 09:29 0  
[SND]seboy.mp32022-08-10 09:26 0  
[SND]TUT.mp32022-08-10 09:26 0  
[SND]KAS.mp32022-08-10 09:25 0  
[SND]anime.mp32022-08-10 09:25 0  
[SND]ASK.mp32022-08-10 09:25 2.9M 
[SND]REMIX1.mp32022-08-10 09:25 3.2M 
[SND]Geometry Dash - SLAUGHTERHOUSE_(MP3Ball.ru).mp32022-08-10 09:23 0  
[SND]MORGENSHTERN, Элджей - Cadillac.mp32022-08-10 09:23 6.8M 
[SND]Molchat_Doma_-_Na_dne_58595703.mp32022-08-10 09:22 0  
[SND]Mil.mp32022-08-10 09:20 0  
[SND]inginusai.mp32022-08-10 09:19 0  
[SND]morgenshtern-feat-eldzhey-cadillac.mp32022-08-10 09:15 0  
[SND]dgt12.mp32022-08-10 09:15 0  
[SND]Bakit.mp32022-08-10 09:15 0  
[SND]какашка pou - игры для всей семьи (1).mp32022-08-10 09:14 0  
[SND]zm1.mp32022-08-10 09:12 44K 
[SND]11678.mp32022-08-10 09:09 0  
[SND]Bugoy.mp32022-08-10 09:07 2.7M 
[SND]jakone_-_kurit__(feat._a.v.g__itachi)_muzati.net.mp32022-08-10 09:06 0  
[SND]Panda.mp32022-08-10 09:01 1.9M 
[SND]NOBITA - IKAW LANG _ Official Lyric Video.mp32022-08-10 08:53 4.0M 
[SND]Because - Marlboro Black.mp32022-08-10 08:53 0  
[SND]Al James - Pahinga (Official Audio).mp32022-08-10 08:53 0  
[SND]Pagsamo - Arthur Nery (Official Music Video).mp32022-08-10 08:53 0  
[SND]Al James - Pa-umaga.mp32022-08-10 08:53 0  
[SND]December Avenue - Huling Sandali (OFFICIAL LYRIC VIDEO).mp32022-08-10 08:53 0  
[SND]Munimuni - Bawat Piyesa (Official Lyric Video).mp32022-08-10 08:53 0  
[SND]Adie - Paraluman (Official Audio).mp32022-08-10 08:53 0  
[SND]727 Clique - Family Day.mp32022-08-10 08:53 0  
[SND]Joji - Sanctuary (Official Video).mp32022-08-10 08:53 2.9M 
[SND]Joji - SLOW DANCING IN THE DARK.mp32022-08-10 08:53 0  
[SND]Munimuni - Sa Hindi Pag-alala (Lyric Video).mp32022-08-10 08:53 0  
[SND]PARASITIKO - Jrldm ft. Lexus (Official Music Video).mp32022-08-10 08:53 0  
[SND]Akala Mo Ata (OMV) - Nateman x Realest Cram x CK YG (Dir. by Lua Swish).mp32022-08-10 08:53 0  
[SND]Akala Mo Ata (feat. Nateman, Realest Cram & CK YG).mp32022-08-10 08:53 0  
[SND]Paraluman sad version.mp32022-08-10 08:53 0  
[SND]UNIQUE - Sino (Official Music Video).mp32022-08-10 08:53 0  
[SND]Fenn7.mp32022-08-10 08:52 0  
[SND]lambi-judai.mp32022-08-10 08:45 0  
[SND]kewer1.mp32022-08-10 08:45 0  
[SND]zara-sa.mp32022-08-10 08:40 0  
[SND]AA.mp32022-08-10 08:38 80K 
[SND]s.mp32022-08-10 08:36 0  
[SND]Rex Orange County - THE SHADE (Official Audio).mp32022-08-10 08:32 0  
[SND]Fenn9Athecraz1.mp32022-08-10 08:31 2.8M 
[SND]djj1.mp32022-08-10 08:17 3.3M 
[SND]Zhu Ni Shengri Kuai Le- Happy Birthday Mandarin Chinese Kid Song Lyrics.mp32022-08-10 08:17 0  
[SND]dj4.mp32022-08-10 08:16 480K 
[SND]A.L.A - Piano (feat. Didine Canon 16).mp32022-08-10 08:08 0  
[SND]NAAN JACKSON.mp32022-08-10 08:07 0  
[SND]Made3.mp32022-08-10 08:07 0  
[SND]Made2.mp32022-08-10 08:07 0  
[SND]Made1.mp32022-08-10 08:07 0  
[SND]OPPANA SONG,.mp32022-08-10 08:04 0  
[SND]POORAM KANAN DJ.mp32022-08-10 08:03 0  
[SND]y2meta.com - VIET DEEP 2022 - HOUSE LAK CHILL ĐI BẠN ƠI, VIỆT MIX 2022 - SET NHẠC CHILL (128 kbps).mp32022-08-10 08:02 44K 
[SND]Fennfenn1.mp32022-08-10 08:02 0  
[SND]FennFenn1.mp32022-08-10 08:00 0  
[SND]Seafret - Atlantis (Lyrics).mp32022-08-10 07:59 0  
[SND]sulthan.mp32022-08-10 07:59 0  
[SND]SHA.mp32022-08-10 07:59 0  
[SND]Ezra6.mp32022-08-10 07:59 0  
[SND]Los.mp32022-08-10 07:58 0  
[SND]Ed Sheeran - Photograph (Official Music Video).mp32022-08-10 07:57 0  
[SND]sulthan 1.mp32022-08-10 07:56 0  
[SND]Vel.mp32022-08-10 07:55 0  
[SND]Nicky Youre, dazy - Sunroof (Official Music Video).mp32022-08-10 07:52 2.7M 
[SND]Kewer.mp32022-08-10 07:49 0  
[SND]a505.mp32022-08-10 07:47 0  
[SND]SARJANA.mp32022-08-10 07:39 0  
[SND]ligaw.mp32022-08-10 07:39 104K 
[SND]DjFenn1.mp32022-08-10 07:39 1.1M 
[SND]DjFenn2.mp32022-08-10 07:38 3.0M 
[SND]hohey.mp32022-08-10 07:29 140K 
[SND]glassanimals.mp32022-08-10 07:29 0  
[SND]djthailand.mp32022-08-10 07:29 0  
[SND]Zexx.mp32022-08-10 07:29 1.2M 
[SND]middle of night.mp32022-08-10 07:29 2.8M 
[SND]man.mp32022-08-10 07:28 4.2M 
[SND]Bentot.mp32022-08-10 07:27 0  
[SND]ZX.mp32022-08-10 07:26 0  
[SND]badcurt-kert-ya-tebya-lyublyu-mp3.mp32022-08-10 07:26 0  
[SND]typeluv-poslan.mp32022-08-10 07:24 0  
[SND]Marikit.mp32022-08-10 07:00 0  
[SND]sad3.mp32022-08-10 06:52 160K 
[SND]Baak_Gmlcineliolu_-_Bir_Anda_73825968.mp32022-08-10 06:49 0  
[SND]blls3.mp32022-08-10 06:39 0  
[SND]:)).mp32022-08-10 06:30 0  
[SND]Troye.mp32022-08-10 06:29 3.1M 
[SND]Xcho_Mr_Lambo_-_Zakryla_dal_74291179.mp32022-08-10 06:27 0  
[SND]tonggiavy.mp32022-08-10 06:27 0  
[SND]MOLLBEN37.mp32022-08-10 06:16 2.8M 
[SND]itoangliga.mp32022-08-10 06:11 3.2M 
[SND]euphoria.mp32022-08-10 06:10 0  
[SND]Demeter_Discoteka.mp32022-08-10 06:02 0  
[SND]RAIKAHO - Психопат.mp32022-08-10 06:01 0  
[SND]HTRCP1.mp32022-08-10 06:00 0  
[SND]dhhje.mp32022-08-10 05:59 0  
[SND]Instrumen Sedih, Instrumen Musik paling Sedih, Instrumen Sedih Bikin Nangis.mp32022-08-10 05:59 0  
[SND]bsata.mp32022-08-10 05:57 0  
[SND]pasaway.mp32022-08-10 05:57 0  
[SND]PSYCHEDELIC BOYZ - RAWSTARR TIL I DIE (BATANG PASAWAY)_160k.mp32022-08-10 05:55 0  
[SND]Rawr8.mp32022-08-10 05:55 0  
[SND]Tekiteki.mp32022-08-10 05:54 0  
[SND]mabagal.mp32022-08-10 05:54 0  
[SND]munimuni.mp32022-08-10 05:54 0  
[SND]Lily of The Valley.mp32022-08-10 05:53 328K 
[SND]papel.mp32022-08-10 05:53 5.8M 
[SND]xinmaruocdau.mp32022-08-10 05:52 0  
[SND]kadhal.mp32022-08-10 05:52 0  
[SND]Kannil.mp32022-08-10 05:51 0  
[SND]Rabbane.mp32022-08-10 05:51 0  
[SND]Lilyofthevalley.m4a2022-08-10 05:49 0  
[SND]ghbd.mp32022-08-10 05:41 2.9M 
[SND]bg.mp32022-08-10 05:39 8.2M 
[SND]AleksMarty_Corrosive.mp32022-08-10 05:38 2.2M 
[SND]Za.mp32022-08-10 05:38 4.0M 
[SND]botsurpdj12.mp32022-08-10 05:38 0  
[SND]FERDZ X ELLA EYS X PACHO - SUNDO (COSA NOSTRA I OST).mp32022-08-10 05:37 0  
[SND]Tetap Dalam Jiwa.mp32022-08-10 05:32 0  
[SND]WENAKK.mp32022-08-10 05:30 0  
[SND]Audioghh.mp32022-08-10 05:27 0  
[SND]ferdzapelyido.mp32022-08-10 05:22 0  
[SND]requestferdz.mp32022-08-10 05:21 0  
[SND]mr7.mp32022-08-10 05:20 3.3M 
[SND]gk tau.mp32022-08-10 05:20 0  
[SND]za.mp32022-08-10 05:19 0  
[SND]fmhdlg.mp32022-08-10 05:19 3.2M 
[SND]DJ ENAKEUNN V4 X MAMA BALE BALE VINKY YT VIRAL TIK TOK TERBARU 2022 YANG KALIAN CARI !.mp32022-08-10 05:16 0  
[SND]mr5.mp32022-08-10 05:16 3.2M 
[SND]frdz.mp32022-08-10 05:14 756K 
[SND]mr4.mp32022-08-10 05:12 3.1M 
[SND]mr3.mp32022-08-10 05:07 2.8M 
[SND]mr2.mp32022-08-10 05:02 2.7M 
[SND]joby101.mp32022-08-10 04:56 892K 
[SND]Jeydii.mp32022-08-10 04:55 752K 
[SND]mr1.mp32022-08-10 04:54 4.6M 
[SND]ulap.mp32022-08-10 04:52 0  
[SND]yellow.mp32022-08-10 04:52 3.2M 
[SND]bmw.mp32022-08-10 04:51 0  
[SND]pano.mp32022-08-10 04:51 3.9M 
[SND]sanctuary.mp32022-08-10 04:50 2.8M 
[SND]somebody.mp32022-08-10 04:50 2.2M 
[SND]pasko.mp32022-08-10 04:43 0  
[SND]Bahanapui.mp32022-08-10 04:40 0  
[SND]sjdajd.mp3.mp32022-08-10 04:38 0  
[SND]Cf.mp32022-08-10 04:32 0  
[SND]SAO.mp32022-08-10 04:28 0  
[SND]Seinpogi.mp32022-08-10 04:22 0  
[SND]Wanna.mp32022-08-10 04:21 3.1M 
[SND]y2mate.com - The Walters I Love You So_320kbps.mp32022-08-10 04:18 0  
[SND]Callip12.mp32022-08-10 04:17 0  
[SND]MannyManny.mp32022-08-10 04:10 0  
[SND]music2.mp32022-08-10 04:08 108K 
[SND]GASAGA.mp32022-08-10 04:07 348K 
[SND]jolen.mp32022-08-10 04:06 661K 
[SND]Suzume-no-Tojimari-Trailer-2-SONG-Suzume-Nanoka-Hara-Lyrics-KAN-ROM-ENG_RO2mt82300Q.mp32022-08-10 03:59 0  
[SND]music1.mp32022-08-10 03:57 3.8M 
[SND]Kiyo x Because - Ano na [Slow remix] PROD. SHORTONE.mp32022-08-10 03:55 0  
[SND]Shanti Dope - Nadarang (Official Music Video).mp32022-08-10 03:50 0  
[SND]Lo ki - Munting Paraiso (Lyrics).mp32022-08-10 03:50 0  
[SND]Lo Ki - Kagome (Official Music Video).mp32022-08-10 03:50 3.7M 
[SND]VAR.mp32022-08-10 03:49 0  
[SND]Dre Dog - Smoke Dope and Rap.mp32022-08-10 03:46 0  
[SND]TEN1.mp32022-08-10 03:38 0  
[SND]bla.mp32022-08-10 03:36 0  
[SND]pln.mp32022-08-10 03:32 1.6M 
[SND]IMG_1243.MOV.mp32022-08-10 03:27 0  
[SND]Hiling.mp32022-08-10 03:22 4.5M 
[SND]AUD-20220605-WA0046.mp32022-08-10 03:20 0  
[SND]AUD-20220314-WA0050.m4a2022-08-10 03:20 0  
[SND]remix.mp32022-08-10 03:19 2.4M 
[SND]АСТМА 3..mp32022-08-10 03:18 0  
[SND]Line.mp32022-08-10 03:15 3.8M 
[SND]Lambi Judai 128 Kbps.mp32022-08-10 03:15 0  
[SND] Zara Sa.mp32022-08-10 03:11 0  
[SND]JhoNT2.mp32022-08-10 03:04 0  
[VID]Better Call Saul - Chuck loses control.mp42022-08-10 03:01 0  
[SND]Cheriimoya_feat._Sierra_Kidd_feat._55_-_living_life_in_the_night_(Gybka.com).mp32022-08-10 02:51 0  
[SND]TAKBO.mp32022-08-10 02:51 0  
[SND]Zachem_mne_solnce_v_Monako_polnaya_versiya_-_Pesnya_73364115.mp32022-08-10 02:51 0  
[SND]LoOk aT aLL tHoSe ElVeS.mp32022-08-10 02:47 0  
[SND]Lil_Nas_X_-_Panini_Official_Video.mp32022-08-10 02:40 0  
[SND]Man Screaming CEEDAY Sound Effect HD.mp32022-08-10 02:38 0  
[SND]CaWa - Balenciaga (www.hotplayer.ru).mp32022-08-10 02:38 0  
[SND]mp3-now.com - Mick Gordon The Only Thing They Fear Is You DOOM Eternal OST High Quality 2020.mp32022-08-10 02:38 0  
[SND]Home_With_Hope.mp32022-08-10 02:36 0  
[SND]dj.mp32022-08-10 02:34 0  
[SND]The Only Thing They Fear Is You ( DOOM Eternal OST High Quality 2021 MICK GORDON).mp32022-08-10 02:34 0  
[SND]dj8.mp32022-08-10 02:30 504K 
[SND]8mb.video-n8U-RPTnuLjT.mp32022-08-10 02:30 0  
[SND]RTX.mp32022-08-10 02:27 0  
[SND]RdV1.mp32022-08-10 02:27 4.0M 
[SND]WhatsApp Audio 2022-08-09 at 3.22.21 PM.mp32022-08-10 02:26 0  
[SND]TLT.mp32022-08-10 02:25 0  
[SND]behind_the_chimney_DEMO_29-5-22_2-1.mp32022-08-10 02:23 0  
[SND]WhatsApp Audio 2022-08-10 at 09.17.47.mp32022-08-10 02:19 0  
[SND]CHOP.mp32022-08-10 02:17 0  
[SND]ajpanalo.mp32022-08-10 02:17 0  
[SND]dj7.mp32022-08-10 02:15 504K 
[SND]dj5.mp32022-08-10 02:15 424K 
[SND]DAK.mp32022-08-10 02:15 4.2M 
[SND]Aisyah.mp32022-08-10 02:13 3.6M 
[SND]intropanalo.mp32022-08-10 02:13 0  
[SND]Turu.mp32022-08-10 02:12 732K 
[SND]Jopay.mp32022-08-10 02:11 4.1M 
[SND]mp7.mp32022-08-10 02:04 4.3M 
[SND]Hmmm.mp32022-08-10 01:42 0  
[SND]Sadboy.mp32022-08-10 01:41 1.1M 
[SND]ecan.mp32022-08-10 01:38 0  
[SND]thangcam.mp32022-08-10 01:33 0  
[SND]Staring at Stars.mp32022-08-10 01:33 0  
[VID]Tastelike Cake - Starring at stars ( Dream Piano Song ).mp42022-08-10 01:30 0  
[SND]Rn17.mp32022-08-10 01:27 0  
[SND]inbound833631831458767416.mp32022-08-10 01:26 0  
[SND]poyuya.mp32022-08-10 01:23 0  
[SND]ngoisaocodon.mp32022-08-10 01:21 0  
[SND]mp2.mp32022-08-10 01:20 3.0M 
[SND]bensound-buddy.mp32022-08-10 01:17 0  
[SND]Musik.mp32022-08-10 01:15 0  
[SND]y2mate.com - ささえる人の歌 back number.mp32022-08-10 01:14 0  
[SND]unwell.mp32022-08-10 01:13 0  
[SND]1575866702_korol_i_shut_vospominaniya_o_byloy_lyubvi.mp32022-08-10 01:11 0  
[SND]SAFESAFE.mp32022-08-10 01:06 0  
[SND]Central Cee Doja Directed by Cole Bennett_2.mp32022-08-10 01:05 0  
[SND]Tokyo Drift - Teriyaki Boyz [ MUSIC VIDEO ] HD.mp32022-08-10 01:03 3.9M 
[SND]Daun Jatuh - Resah Jadi Luka (Official Audio).mp32022-08-10 01:03 0  
[SND]seandainya - vierra (slowed reverb lyrics).mp32022-08-10 01:03 0  
[SND]LAST CHILD - BERNAFAS TANPAMU (Lirik Lyric).mp32022-08-10 01:03 0  
[SND]Covidv.mp32022-08-10 01:02 0  
[SND]covidvibes.mp32022-08-10 01:00 0  
[SND]hey_loser_you_scared_yes.mp32022-08-10 00:49 0  
[VID]VID_20220810015523.mp42022-08-10 00:41 0  
[SND]y2mate.com - Story Wa Anime AOT Lagu Sasageyo.mp32022-08-10 00:24 0  
[SND]Vyacheslav Mescherin Orchestra - Frogs.mp32022-08-10 00:13 0  
[SND]AUD-20220804-WA0000.mp32022-08-09 23:57 0  
[SND]Al_Bakara.mp32022-08-09 23:55 0  
[SND]Sura_2_Al-Bakara_Korova_-_Korana_na_arabskom_s_perevodom_na_russkij_yazyk._(iPleer.com).mp32022-08-09 23:51 0  
[SND]Fireboy_DML_ft_Asake_-_Bandana_AstroBaze.com.mp32022-08-09 23:32 0  
[SND]Fireboy_DML_-_Change_AstroBaze.com.mp32022-08-09 23:30 0  
[SND]vp11.mp32022-08-09 23:28 0  
[SND]kanjut.mp32022-08-09 23:25 0  
[VID]Vp1.mp42022-08-09 23:13 0  
[SND]Y2Mate.is - Indila - Tourner Dans Le Vide-vtNJMAyeP0s-160k-1660086324721.mp32022-08-09 23:06 0  
[SND]vs3.mp32022-08-09 22:55 0  
[SND]vs2.mp32022-08-09 22:54 0  
[SND]vs1.mp32022-08-09 22:54 0  
[SND]Юлия_Савичева_Не_смотри_PHONK_EDITION_BY_KINEZIS.mp32022-08-09 22:53 1.2M 
[SND]one direction - strong.mp32022-08-09 22:42 0  
[SND]قراءة منظومة الزمزمي_ _للقارئ علي صلاح عمر_ مركز تكوين المفسر.mp32022-08-09 22:29 0  
[VID]carlos-vives-ft-shakira-la-bicicleta-by-elin-manny-ens-letra_smnQolF2.mp42022-08-09 22:19 0  
[SND]tian1.mp32022-08-09 22:12 0  
[SND]teste.mp32022-08-09 22:12 44K 
[SND]Sc3.mp32022-08-09 22:10 2.7M 
[SND]Derya Uluğ - Kanunlar Gibi (Mert Kurt Remix).mp32022-08-09 22:05 0  
[VID]carlos-vives-ft-shakira-la-bicicleta-by-elin-manny-ens-letra_MwoYl7Yg.mp42022-08-09 22:03 0  
[SND]toro1.mp32022-08-09 21:55 4.1M 
[SND]OVERTIME ROUGH DRAFT (working on).mp32022-08-09 21:53 4.7M 
[SND]Rainy Day yes vocals first mix (online-audio-converter.com)(2).mp32022-08-09 21:50 0  
[SND]Neck_Deep_-_December(128k).mp32022-08-09 21:48 0  
[SND]logingnlrp.mp32022-08-09 21:48 0  
[SND]IShowSpeed - Shake (Official Music Video).mp32022-08-09 21:44 0  
[SND]one-shot-a-la-conquete_456239046.mp32022-08-09 21:44 0  
[SND]loginlrp.m4a2022-08-09 21:42 420K 
[SND]Adur.mp32022-08-09 21:42 2.2M 
[SND]Grey.mp32022-08-09 21:39 2.9M 
[SND]Самурай.mp32022-08-09 21:25 0  
[SND]mp3-now.com - Eminem Dr Dre 50 Cent Crack A Bottle Official Video.mp32022-08-09 21:25 0  
[SND]CALLX_9-8-2022_21-49-21_01096076324.mp32022-08-09 21:25 0  
[SND]INSTASAMKA_-_moneyken-love.mp32022-08-09 21:18 0  
[SND]Scally_Milano_163ONMYNECK_-_Swag_73511571.mp32022-08-09 21:16 0  
[SND]wshr1.mp32022-08-09 21:05 0  
[SND]ER3.mp32022-08-09 21:04 0  
[SND]ER2.mp32022-08-09 21:03 0  
[SND]Myusl_-_Kurwa_Bobr_74481210.mp32022-08-09 20:55 0  
[SND]oo.mp32022-08-09 20:51 1.7M 
[SND]BB8.mp32022-08-09 20:51 0  
[SND][YT2mp3.info] - Arctic Monkeys - Do I Wanna Know_ (Official Video) (320kbps).mp32022-08-09 20:42 0  
[SND]Sting_money_Audio_425507.mp32022-08-09 20:35 0  
[SND]Batu2.mp32022-08-09 20:32 0  
[SND]Batu1.mp32022-08-09 20:32 8.0M 
[SND]ii.mp32022-08-09 20:22 4.5M 
[SND]MyBandaMiyagi.mp32022-08-09 20:11 3.7M 
[SND]SANTUY.mp32022-08-09 20:10 2.7M 
[SND]Selamat Pagi Dunia Tipu Tipu.mp32022-08-09 20:09 0  
[SND]DeadList1.mp32022-08-09 20:08 0  
[SND]DvLidhouse.mp32022-08-09 20:06 0  
[SND]DJ GO SAMPE BAWAH OMO KUCRUT VIRAL TIK TOK TERBARU 2022 YANG KALIAN CARI .mp32022-08-09 20:03 0  
[SND]NangDumatingKa.mp32022-08-09 20:03 0  
[SND]MiyaGi_My_Banda_[www.UZmir.net].mp32022-08-09 20:01 0  
[SND]DDTrack.mp32022-08-09 19:58 0  
[SND]Nang Dumating Ka - Bandang Lapis (Official Lyric Video).mp32022-08-09 19:57 0  
[SND]MiyaGi & Эндшпиль & МанТана - Моя Банда [www.UZmir.net].mp32022-08-09 19:55 0  
[SND]ENIGMA - CAMRY 3.5 (slow remix) (www.hotplayer.ru).mp32022-08-09 19:51 0  
[SND]NDMK.mp32022-08-09 19:47 0  
[SND]mimpi.mp32022-08-09 19:43 2.6M 
[SND]lagimuah.mp32022-08-09 19:42 0  
[SND]Чистое Небо - Гитара 16 (1).mp32022-08-09 19:35 0  
[SND]Павел Пламенев - Эй мёртвый! Проснись! (акустика).mp32022-08-09 19:33 0  
[SND]Wonder.mp32022-08-09 19:29 0  
[SND]Miracle.mp32022-08-09 19:25 0  
[SND]Crazier.mp32022-08-09 19:20 284K 
[SND]Cutie.mp32022-08-09 19:15 2.6M 
[SND]Ako.mp32022-08-09 19:13 0  
[SND]sforek.mp32022-08-09 19:11 0  
[SND]sax.mp32022-08-09 19:08 0  
[SND]tulok.mp32022-08-09 19:08 0  
[SND]Might.mp32022-08-09 19:07 0  
[SND]CHABAH2 (درجة الصوت -0.05 - سرعة إيقاع 103).mp32022-08-09 19:06 0  
[SND]mrv01.mp32022-08-09 19:05 0  
[SND]gimn-sssr-rossii-instrumentalnaya-zapis.mp32022-08-09 19:04 4.7M 
[SND]CHABAH2.mp32022-08-09 19:03 0  
[SND]mrv.mp32022-08-09 19:00 0  
[SND]TIOO.mp32022-08-09 18:56 0  
[SND]Tioosj.mp32022-08-09 18:56 0  
[SND]ning1.mp32022-08-09 18:52 0  
[SND]ning2.mp32022-08-09 18:52 0  
[SND]ning3.mp32022-08-09 18:52 0  
[SND]ning5.mp32022-08-09 18:51 0  
[SND]ning4.mp32022-08-09 18:51 0  
[SND]ssstik.io_1657432160661.mp32022-08-09 18:51 0  
[SND]Dj Bbhc Pyramid.mp32022-08-09 18:51 0  
[SND]rz1.mp32022-08-09 18:50 0  
[SND]SaveTube.App - Eiyuu (Ultraman Nexus Operning) Lyrics (128 kbps) (1).mp32022-08-09 18:50 0  
[SND]SaveTube.App - Eiyuu (Ultraman Nexus Operning) Lyrics (128 kbps).mp32022-08-09 18:49 0  
[SND]JElektroforez_-_505_Legko_sojjti_s_uma_72662961.mp32022-08-09 18:48 0  
[SND]fenicks.mp32022-08-09 18:47 0  
[SND]Bones - Timberlake (ft. Juicy J).mp32022-08-09 18:47 0  
[SND]FelixVander.mp32022-08-09 18:44 5.9M 
[SND]grave!.mp32022-08-09 18:39 3.3M 
[SND]Koy.mp32022-08-09 18:37 8.9M 
[SND]N4.mp32022-08-09 18:33 0  
[SND]Record (online-voice-recorder.com).mp32022-08-09 18:30 0  
[SND]Not Around - Nova.mp32022-08-09 18:30 0  
[SND]touch.mp32022-08-09 18:28 3.5M 
[SND]1515401487_gazirovka-black-www_muzonov_net.mp32022-08-09 18:28 0  
[SND]hamd.mp32022-08-09 18:27 0  
[SND]dqsng.mp32022-08-09 18:27 0  
[SND]hehe.mp32022-08-09 18:27 0  
[SND]1096.mp32022-08-09 18:25 0  
[SND]ᴘᴏ_ᴋᴀɪꜰᴜ_🍷_кайфуша'_🤤✌🏿_Мастер_И_Маргарита(1).mp32022-08-09 18:24 0  
[SND]walwal.mp32022-08-09 18:24 6.3M 
[SND]Sohigh.mp32022-08-09 18:24 0  
[SND]KRK FtNA Official MV Prod By Sakarin.mp32022-08-09 18:20 0  
[SND]So High.mp32022-08-09 18:17 0  
[SND]Bruno Mars, Anderson .Paak, Silk Sonic - Smokin Out The Window.mp32022-08-09 18:17 0  
[SND]zhalan-dunie-zhalan-eken.mp32022-08-09 18:15 0  
[SND]Suzume.mp32022-08-09 18:15 0  
[SND]Сектор Газа - ЛИРИКА PHONK EDITION PROD NERONUS (mp3-2020.com).mp32022-08-09 18:14 0  
[SND]jackmafia100.mp32022-08-09 18:13 0  
[SND]Press2pNick - John Muir.mp32022-08-09 18:13 0  
[SND]djhie1.mp32022-08-09 18:12 0  
[SND]Tulus - Monokrom - sped up.mp32022-08-09 18:12 0  
[SND]zhalan-dunie-zhalan-eken_(muzzona.kz).mp32022-08-09 18:11 0  
[SND]Malaak_Op.mp32022-08-09 18:11 0  
[SND]Mlk_1.mp32022-08-09 18:10 448K 
[SND]DJ CLOSE YOUR EYES X GAM GAM TEKI TEKI VIRAL TIKTOK‼️DJ TIKTOK REMIX VIRAL 2022‼️.mp32022-08-09 18:05 4.0M 
[SND]Тима Белорусских - Знаток.mp32022-08-09 18:05 7.1M 
[SND]FelixGans.mp32022-08-09 18:04 31M 
[SND]Sc2.mp32022-08-09 18:04 3.6M 
[SND]Sc1.mp32022-08-09 18:04 3.2M 
[SND]Hujan.mp32022-08-09 18:04 1.7M 
[SND]dora-doradura-mp3 (1).mp32022-08-09 17:57 0  
[SND]MAHIKA.mp32022-08-09 17:55 3.1M 
[SND]modern-talking-cheri-cheri-lady.mp32022-08-09 17:54 0  
[SND]helmandj7.mp32022-08-09 17:53 3.3M 
[SND]ЧЁРНЫЕ ГЛАЗА - (phonk edition) (mp3day.net).mp32022-08-09 17:51 0  
[SND]helmandj8.mp32022-08-09 17:51 0  
[SND]Seinsong.mp32022-08-09 17:49 0  
[SND]10467-irina-kairatovna-shiza-kok-tu.mp32022-08-09 17:48 0  
[SND]X2Download.app - PtrpStudio - ชอบเธออะ (Prod by. Sakarin) (128 kbps).mp32022-08-09 17:46 0  
[SND]Sein1.mp32022-08-09 17:44 556K 
[SND]sad45.mp32022-08-09 17:44 0  
[SND]zawsze.mp32022-08-09 17:43 0  
[SND]X2Download.com - UN Owen Was Her - Nico Nico Douga ~ Ronald McDonald (128 kbps).mp32022-08-09 17:42 0  
[SND]fabdoua.mp32022-08-09 17:40 0  
[SND]alltype.mp32022-08-09 17:37 0  
[SND]St1.mp32022-08-09 17:35 3.4M 
[SND]SnapTik_7124337818679201050.mp32022-08-09 17:35 0  
[SND]savannah.mp32022-08-09 17:35 0  
[SND]Tulusinteraksi3.mp32022-08-09 17:34 0  
[SND]Tulusjuni2.mp32022-08-09 17:33 0  
[SND]icalsad.mp32022-08-09 17:33 0  
[SND]Pesanterakhir1.mp32022-08-09 17:33 0  
[VID]SnapTik_7126513311683743003.mp42022-08-09 17:30 0  
[SND]Until I Found You 💛Newest Arthur Miguel Non Stop Playlist 2022💛Bagong OPM Ibig Kanta 2022.mp32022-08-09 17:30 0  
[SND]TINDER ROLEPLAY - PROD BY MANGBORIS (Official Audio).mp32022-08-09 17:29 0  
[SND]#AJIMAT⚡ - MY GANG! (Official Music Video).mp32022-08-09 17:27 0  
[SND]sein.mp32022-08-09 17:26 0  
[SND]strumble.mp32022-08-09 17:25 0  
[SND]Dito.mp32022-08-09 17:25 3.5M 
[SND]sikok bagi duo.mp32022-08-09 17:21 0  
[SND]Vendetta - Этот Дым - Miro Pircxalava.mp32022-08-09 17:20 0  
[SND]Скриптонит - Пацан [Chill Vibe Version by ERWI] - Constant Music.mp32022-08-09 17:20 0  
[SND]Иду Как И Шел - INFINITY MUSIC.mp32022-08-09 17:20 0  
[SND]Веселей - Скриптонит.mp32022-08-09 17:20 0  
[SND]ендшпиль-гости уйдут - legenda_13.mp32022-08-09 17:20 0  
[SND]Train Wreck - kizaru.mp32022-08-09 17:20 0  
[SND]Metro Pro - Valiko - Nextgen.mp32022-08-09 17:20 0  
[SND]50 сеnt & Каспийский груз disco inferno - ☠️𝕯𝖊𝖆𝖉𝖑𝛄 𝖒𝖚𝖘𝖎𝖈☠️.mp32022-08-09 17:20 0  
[SND]H8.HOOD - PHANTOM (official music) - 1agares1.mp32022-08-09 17:20 0  
[SND]01. Делюгу - Макухин.mp32022-08-09 17:20 0  
[SND]First Day Out - kizaru.mp32022-08-09 17:20 0  
[SND]DAIS - Glock - DAIS.mp32022-08-09 17:20 0  
[SND]03. Его Крышуют Мусара - Макухин.mp32022-08-09 17:20 0  
[SND]•Как мне жаль ваши души• - Mara$ladkiy.mp32022-08-09 17:19 0  
[SND]TRT.mp32022-08-09 17:19 0  
[SND]2008.mp32022-08-09 17:18 2.1M 
[SND]tom1.mp32022-08-09 17:17 0  
[SND]HUM.mp32022-08-09 17:17 0  
[SND]chien.mp32022-08-09 17:15 0  
[SND]odel.mp32022-08-09 17:14 0  
[SND]yeu.mp32022-08-09 17:14 0  
[SND]TST.mp32022-08-09 17:13 0  
[SND]showw.mp32022-08-09 17:13 0  
[SND]We asked Richard how he integrates rhetoric and phonetic delivery in his training and what is the unique methodology behind it (1).mp32022-08-09 17:12 0  
[SND]FIRST CONTACT STORIES OF THE CALL CENTER NOBELBIZ PODCAST. One of Richard Blank’s (CEO of Costa Rica's Call Center) strong suits is gamification company culture (3).mp32022-08-09 17:12 0  
[SND]FIRST CONTACT STORIES OF THE CALL CENTER NOBELBIZ PODCAST. One of Richard Blank’s (CEO of Costa Rica's Call Center) strong suits is balancing his time as a leader (2).mp32022-08-09 17:12 0  
[SND]despacito.mp32022-08-09 17:12 4.3M 
[SND]During COVID-19, Costa Rica's Call Center's CEO, Richard Blank managed to keep having successful interactions, happy customers and engaged employees (1).mp32022-08-09 17:12 0  
[SND]The Art and Science of Call Center Success, with Richard Blank from Costa Rica's Call Center - Cutter Consulting Group.mp32022-08-09 17:11 0  
[SND]aboba.mp32022-08-09 17:10 0  
[SND]DJ Chechen - Чеченская лезгинка.mp32022-08-09 17:08 772K 
[SND]alo.mp32022-08-09 17:08 4.3M 
[SND]arcannistrp.mp32022-08-09 17:06 0  
[SND]arc.mp32022-08-09 17:06 0  
[SND]saep1.mp32022-08-09 17:03 0  
[SND]Dan.mp32022-08-09 17:02 2.4M 
[SND]ngoisao.mp32022-08-09 16:57 0  
[SND]vf.mp32022-08-09 16:56 0  
[SND]sando.mp32022-08-09 16:53 0  
[SND]y2mate.com_-_GTARPNETWORK_Heading.mp32022-08-09 16:52 0  
[SND]itsyouu.mp32022-08-09 16:48 0  
[SND]Diz3.mp32022-08-09 16:47 0  
[SND]wannamarry.mp32022-08-09 16:46 0  
[SND]Defamilita.mp32022-08-09 16:41 0  
[SND]Tadhana.mp32022-08-09 16:37 1.0M 
[SND]ligaya.mp32022-08-09 16:34 444K 
[SND]Katha.mp32022-08-09 16:33 0  
[SND]Ito.mp32022-08-09 16:33 0  
[SND]mhine.mp32022-08-09 16:33 0  
[SND]Ligaya.mp32022-08-09 16:32 0  
[SND]behh.mp32022-08-09 16:32 0  
[SND]Tokyo Ghoul - Opening (original).mp32022-08-09 16:32 0  
[SND]6IX9INE - POLICE ft. 50 Cent (RapKing Music Video)(MP3_320K).mp32022-08-09 16:31 0  
[SND][YT2mp3.info] - Mehro - perfume (Lyrics) (320kbps).mp32022-08-09 16:31 0  
[SND]kane + ketceh 😎☝.mp32022-08-09 16:27 0  
[SND]m49.mp32022-08-09 16:26 0  
[SND]lot.mp32022-08-09 16:26 0  
[SND]kash.mp3.mp32022-08-09 16:25 0  
[SND]youu.mp32022-08-09 16:25 0  
[SND]FiiyOzawa.mp32022-08-09 16:22 0  
[SND]DanMachi Season 4 Opening FullTentouby Sajou no Hana.mp32022-08-09 16:21 0  
[SND]Liga.mp32022-08-09 16:21 0  
[SND]Mine.mp32022-08-09 16:20 0  
[SND]BASS.mp32022-08-09 16:20 0  
[SND]inbound6601697356567906970.mp32022-08-09 16:16 0  
[SND]Metan_-_SHnurki_73239954.mp32022-08-09 16:16 0  
[SND]BASS1.mp32022-08-09 16:15 0  
[SND]y2mate.com - DJ JEDAG JEDUG FULL BASS Lagu tik tok viral 2021 WilfexBor Terbaru (1).mp32022-08-09 16:15 0  
[SND]inbound7796932345223699318.mp32022-08-09 16:14 0  
[SND]ajh.mp32022-08-09 16:08 0  
[SND]musica-the-descent-kevin-macleod.mp32022-08-09 16:07 0  
[SND]wax1.mp32022-08-09 16:05 0  
[SND]trac.mp32022-08-09 16:05 0  
[SND]zlij_reper_zenik_-_gmo_(z2.fm).mp32022-08-09 15:58 0  
[SND]TP1.mp32022-08-09 15:48 0  
[SND]Sound1.mp32022-08-09 15:48 0  
[SND]Zxa12.mp32022-08-09 15:48 0  
[SND]Zxa11.mp32022-08-09 15:47 0  
[SND]Zxa10.mp32022-08-09 15:47 0  
[SND]lil-tecca-ransom-directed-by-cole-bennett-ytmp3juice.mp32022-08-09 15:45 0  
[SND]tiktok-i-just-can-t‼️-kevin-rater-remix-2021-ytmp3juice.mp32022-08-09 15:45 0  
[SND]mzlff-Нерпы все в адидасах (Original Version) [Peanzo Remix].mp32022-08-09 15:43 0  
[SND]DJBLDABTCH.mp32022-08-09 15:43 0  
[SND]LZ1.mp32022-08-09 15:42 0  
[SND]LZ3.mp32022-08-09 15:42 0  
[SND]LZ2.mp32022-08-09 15:42 0  
[SND]LZ5.mp32022-08-09 15:42 0  
[SND]LZ7.mp32022-08-09 15:42 0  
[SND]LZ6.mp32022-08-09 15:42 0  
[SND]Skofka_Nu_a_poki_budem_bit_vas_za_azov_i_Buchu.mp32022-08-09 15:41 0  
[SND]Eorp.mp32022-08-09 15:39 0  
[SND]high.mp32022-08-09 15:38 0  
[SND]y2mate.com - Rizky Febian Seperti Kisah Official Lyric Video.mp32022-08-09 15:37 0  
[SND]LZ.mp32022-08-09 15:36 2.4M 
[SND]DJ BUILD A BITCH.mp32022-08-09 15:35 0  
[SND]ตบไมเคิ้ลเนเวอร์เฟียร์ By ทุเรียนซิ่ง.mp32022-08-09 15:35 0  
[SND]ตบไมเคิ้ลเนเวอร์เฟียร์ By ทุเรียนซิ่ง (online-audio-converter.com).mp32022-08-09 15:34 0  
[SND]nai.mp32022-08-09 15:32 0  
[SND]vadcb.mp32022-08-09 15:29 0  
[SND]y2mate.com - iPhone New phone ringtone 2020 Best iPhone ringtone 2020 Apple ringtone 2020 download.mp32022-08-09 15:27 0  
[SND]Song10.mp32022-08-09 15:26 0  
[SND]HEE.mp32022-08-09 15:20 2.8M 
[SND]y2mate.com - I Like You So Much Youll Know It Ysabelle Cuevas Lyrics .mp32022-08-09 15:15 1.0M 
[SND]jackking.mp32022-08-09 15:14 0  
[SND]megalovania.mp32022-08-09 15:13 0  
[SND]mp3-2217615439921085-160687952498285.mp32022-08-09 15:13 0  
[SND]bls9.mp32022-08-09 15:12 0  
[SND]zaxn1.mp32022-08-09 15:10 0  
[SND]life.mp32022-08-09 15:10 0  
[SND]joby102.mp32022-08-09 15:06 0  
[SND]ransom.mp32022-08-09 15:04 0  
[SND]incalabas3.mp32022-08-09 15:03 0  
[SND]U-Rays (Tutorial) - F-Zero GX [OST].mp32022-08-09 15:03 232K 
[SND]oopkmmmm.mp32022-08-09 15:03 0  
[SND]9amincalabasas.mp32022-08-09 15:02 0  
[SND]ll1.mp32022-08-09 15:02 0  
[SND]FFMAX.mp32022-08-09 15:00 0  
[SND]kkkkkkkho.mp32022-08-09 14:59 3.1M 
[SND]walk.mp32022-08-09 14:59 4.2M 
[SND]chuta5.mp32022-08-09 14:58 0  
[SND]chuta4.mp32022-08-09 14:58 0  
[SND]chuta3.mp32022-08-09 14:58 0  
[SND]chuta2.mp32022-08-09 14:58 0  
[SND]chuta.mp32022-08-09 14:58 0  
[SND]chuta1.mp32022-08-09 14:58 0  
[SND]Travis Scott - Antidote (Lyrics On Screen).mp32022-08-09 14:56 0  
[SND]y2mate.com - Arctic Monkeys I Wanna Be Yours Lyrics.mp32022-08-09 14:56 0  
[SND]CallGirl-TrungTu-7344918.mp32022-08-09 14:53 0  
[SND]Redoxy Был друг стал враг_9zbk.mp32022-08-09 14:50 0  
[SND]vacation.mp32022-08-09 14:50 0  
[SND]uuwian.mp32022-08-09 14:49 0  
[SND]paypal-hold-song.mp32022-08-09 14:49 0  
[SND]savage.mp32022-08-09 14:49 0  
[SND]options.mp32022-08-09 14:48 0  
[SND]lintik.mp32022-08-09 14:48 0  
[SND]lifegoeson.mp32022-08-09 14:48 3.2M 
[SND]kungikay.mp32022-08-09 14:47 1.5M 
[SND]itsyou.mp32022-08-09 14:47 1.5M 
[SND]ispy.mp32022-08-09 14:47 0  
[SND]heatwaves.mp32022-08-09 14:47 3.2M 
[SND]habangbuhay.mp32022-08-09 14:46 3.8M 
[SND]deathbed.mp32022-08-09 14:46 1.1M 
[SND]comethru.mp32022-08-09 14:46 0  
[SND]chilllang.mp32022-08-09 14:46 4.5M 
[SND]buwan.mp32022-08-09 14:45 7.8M 
[SND]bilog.mp32022-08-09 14:45 1.5M 
[SND]beautiful.mp32022-08-09 14:45 4.5M 
[SND]io1.mp32022-08-09 14:41 0  
[SND]Pa.mp32022-08-09 14:39 0  
[SND]Pala1.mp32022-08-09 14:38 0  
[SND]Tiara01.mp32022-08-09 14:37 0  
[SND]snowfall.mp32022-08-09 14:37 0  
[SND]wells-hold-song.mp32022-08-09 14:37 1.3M 
[SND]prokol.mp3.mp32022-08-09 14:36 0  
[SND]Glen1.mp32022-08-09 14:34 0  
[SND]Pala.mp32022-08-09 14:33 1.5M 
[SND]Newsong70.mp32022-08-09 14:31 0  
[SND]Glen17.mp32022-08-09 14:31 1.1M 
[SND]music.mp32022-08-09 14:31 764K 
[SND]topromanticsong.mp32022-08-09 14:31 0  
[SND]PALEDES.mp32022-08-09 14:28 0  
[SND]bass.mp32022-08-09 14:28 4.9M 
[SND]djcuky2.mp32022-08-09 14:26 1.1M 
[SND]Wells Fargo Hold Music (2021).mp32022-08-09 14:21 1.3M 
[SND]Theo1.mp32022-08-09 14:21 135K 
[SND]Sukzessive Approximation (DJ Cannabis Coffeeshops Deutschland).mp32022-08-09 14:20 0  
[SND]2019-03-17_-_Too_Crazy_-_David_Fesliyan.mp32022-08-09 14:19 0  
[SND]Lucky1.mp32022-08-09 14:14 0  
[SND]Sad3.mp32022-08-09 14:13 840K 
[SND][YT2mp3.info] - Joji - Glimpse of Us (320kbps).mp32022-08-09 14:10 8.9M 
[SND]VaGanza.mp32022-08-09 14:10 0  
[SND][YT2mp3.info] - Beach Bunny - Cloud 9 (Official Music Video) (320kbps).mp32022-08-09 14:09 0  
[SND]rascal.mp32022-08-09 14:05 0  
[SND]Highway.mp32022-08-09 14:03 0  
[SND]FullSenyum.mp32022-08-09 13:59 4.2M 
[SND]LOVE.mp32022-08-09 13:59 0  
[SND]panda.mp32022-08-09 13:56 4.8M 
[SND]PecahSeribu.mp32022-08-09 13:56 0  
[SND]test1.mp32022-08-09 13:54 4.2M 
[SND]life3.mp32022-08-09 13:53 0  
[SND]cars1.mp32022-08-09 13:52 0  
[SND]Djfede1.mp32022-08-09 13:48 0  
[SND]kolor.mp32022-08-09 13:46 0  
[SND]SAMSONS.mp32022-08-09 13:44 0  
[SND]ganda.mp32022-08-09 13:40 0  
[SND]Hills.mp32022-08-09 13:39 0  
[SND]PARALUMAN.mp32022-08-09 13:39 0  
[SND]RagnBone Man - Human.mp32022-08-09 13:35 0  
[SND]prombl_-_myulee_(musmore.com).mp32022-08-09 13:30 0  
[SND]Sweet.mp32022-08-09 13:28 3.4M 
[SND]Mehabooba.mp32022-08-09 13:27 1.2M 
[SND]Chill.mp32022-08-09 13:25 72K 
[SND]Bmw.mp32022-08-09 13:24 2.5M 
[SND]abtag5.mp32022-08-09 13:22 0  
[SND]moonnik.mp32022-08-09 13:19 0  
[SND]MOON.mp32022-08-09 13:17 0  
[SND]THUONGQUAXA.mp32022-08-09 13:17 0  
[SND]united in flames cut.mp32022-08-09 13:16 0  
[SND]KaiZ2.mp32022-08-09 13:13 0  
[SND]EroplanongPapel.mp32022-08-09 13:12 0  
[SND]Until5.mp32022-08-09 13:12 0  
[SND]Idealessappealing.mp32022-08-09 13:09 0  
[SND]AMALEDI (1).mp32022-08-09 13:09 0  
[SND]PTT-20220809-WA0025.mp32022-08-09 13:08 0  
[SND]box.mp32022-08-09 13:08 1.8M 
[SND]Fai Rumore (ESC 2022 SF1 Live).mp32022-08-09 13:07 0  
[SND]Asmodeus - AI.mp32022-08-09 13:07 0  
[SND]y2meta.com - Last Child - DUKA (Official Lyric Video) (128 kbps).mp32022-08-09 13:05 0  
[SND]ssstik.io_1659706519639.mp32022-08-09 13:05 0  
[SND]Beruntung.mp32022-08-09 13:04 0  
[SND]Asmodeus - AI.m4a2022-08-09 13:04 0  
[SND]parti2.mp32022-08-09 13:01 0  
[SND]playlist-sad-2hour.mp32022-08-09 13:00 0  
[SND]haroun.mp32022-08-09 12:58 0  
[SND]Rain World THS - Garbage City Shuffle.mp32022-08-09 12:55 0  
[SND]dangdutslebew1.mp32022-08-09 12:55 0  
[SND]inbound4252352553164717993.mp32022-08-09 12:55 0  
[SND]snap1.mp32022-08-09 12:54 0  
[SND]tegar.mp32022-08-09 12:52 3.6M 
[SND]Darci2.mp32022-08-09 12:51 0  
[SND]Big_Baby_Tape_kizaru_-_99_Problems_73212020.mp32022-08-09 12:51 6.2M 
[SND]better.mp32022-08-09 12:50 3.2M 
[SND]y2mate.com - Eyes blue or brown cant remember terpikat senyummu Heather X Eyes Blue Lirik Dan Terjemahan.mp32022-08-09 12:50 0  
[SND]Luha.mp32022-08-09 12:50 0  
[SND]y5.mp32022-08-09 12:50 0  
[SND]y4.mp32022-08-09 12:50 0  
[SND]y2.mp32022-08-09 12:49 0  
[SND]y3.mp32022-08-09 12:49 0  
[SND]y1.mp32022-08-09 12:49 0  
[SND]Ballin Down.mp32022-08-09 12:47 0  
[SND]Porque.mp32022-08-09 12:45 0  
[SND]mp1.mp32022-08-09 12:41 1.7M 
[SND]Darci.mp32022-08-09 12:39 0  
[SND]Kambulat — Но ты кидаешь в игнор (Muzqa.net) (www.lightaudio.ru).mp32022-08-09 12:38 0  
[SND]Empilight.mp32022-08-09 12:36 0  
[SND]Oliver.mp32022-08-09 12:36 0  
[SND]ЛИТВИНЕНКО - Исправим.mp32022-08-09 12:36 2.4M 
[SND]y2mate.com - DARCION MY OWN LYRICS.mp32022-08-09 12:35 0  
[SND]JIKA.mp32022-08-09 12:32 0  
[SND]Har20.mp32022-08-09 12:31 3.6M 
[SND]tiengxehoi.mp32022-08-09 12:21 0  
[SND]y2mate.com - New GM ChevyGMCCadillac Door Chime Sound Effect HQ.mp32022-08-09 12:20 0  
[SND]adsasdasd.mp32022-08-09 12:12 0  
[SND]vjudjhfgkvgz.mp32022-08-09 12:11 0  
[SND]bollywoodFM - Детство.mp32022-08-09 12:11 3.0M 
[SND]1650353842_2xrkrnskpsn2022rk8fbcq0k128kbs.mp32022-08-09 12:08 8.8M 
[SND]washing.mp32022-08-09 12:05 1.8M 
[SND]mscrumby.mp32022-08-09 12:04 2.1M 
[SND]nokomens.mp32022-08-09 11:54 5.9M 
[SND]rfquake.mp32022-08-09 11:52 4.2M 
[SND]lmanana.mp32022-08-09 11:51 8.8M 
[SND]crmby.mp32022-08-09 11:51 2.1M 
[SND]campuran.mp32022-08-09 11:48 53M 
[SND]Crazy - Patrick Patrikios.mp32022-08-09 11:44 5.1M 
[SND]Макс Корж - 2 типа людей.mp32022-08-09 11:43 9.8M 
[SND]s2.mp32022-08-09 11:38 4.3M 
[SND]10.mp32022-08-09 11:35 172K 
[SND]Iskorpio - MABAGHICH (Official Music Audio).[Mpgun.com].mp32022-08-09 11:32 0  
[SND]naruto.mp32022-08-09 11:32 0  
[SND]rege2.mp32022-08-09 11:31 0  
[SND]XD.mp32022-08-09 11:31 0  
[SND]KarnaMereka - Cerita Malam (Lirik).mp32022-08-09 11:30 0  
[SND]Randa1.mp32022-08-09 11:29 1.5M 
[SND]Akin.mp32022-08-09 11:28 0  
[SND]dopan.mp32022-08-09 11:27 0  
[SND]KLIA.mp32022-08-09 11:27 0  
[SND]vtornik_-_Dzhoni_Vonker_73215538.mp32022-08-09 11:25 0  
[SND]mp5.mp32022-08-09 11:25 4.9M 
[SND]listrap1.mp32022-08-09 11:24 22M 
[SND]listrap.mp32022-08-09 11:24 19M 
[SND]KVA1.mp32022-08-09 11:21 128K 
[SND]mp4.mp32022-08-09 11:17 3.2M 
[SND]kelaz.mp32022-08-09 11:16 0  
[SND]ha1.mp32022-08-09 11:16 1.8M 
[SND]mp3.mp32022-08-09 11:15 1.1M 
[SND]AUD-20220124-WA0172.mp32022-08-09 11:13 0  
[SND]SNA.mp32022-08-09 11:13 0  
[SND]Кино - Закрой за мной дверь, я ухожу.mp32022-08-09 11:12 0  
[SND]no3.mp32022-08-09 11:12 0  
[SND]SHINE7.mp32022-08-09 11:12 0  
[SND]Beethoven Violin concerto 3rd movement, Toshiya Eto soloist.mp32022-08-09 11:11 0  
[SND]xxxmanera-never-broke-again-mp3.mp32022-08-09 11:09 0  
[SND]no1.mp32022-08-09 11:09 0  
[VID]WhatsApp Audio 2022-08-08 at 11.06.32 AM.mp42022-08-09 11:09 0  
[SND]no2.mp32022-08-09 11:08 0  
[SND]Jakomo, A.V.G, MACAN - Самый молодой.mp32022-08-09 11:08 0  
[SND]🔊💣😈Iliusha🔊💣😈-🖤 Пару водников 🖤-kissvk.com.mp32022-08-09 11:07 0  
[SND]ТГК - Там таз стелит.mp32022-08-09 11:07 1.0M 
[SND]ha.mp32022-08-09 11:06 2.0M 
[SND]ilja_toka__tutbass_-_ilja_toka__tam__gde_nam_ksenon_osveshchaet_tuman_(z2.fm).mp32022-08-09 11:03 6.6M 
[VID]DJ1.mp42022-08-09 11:02 0  
[SND]PD.mp32022-08-09 10:59 2.3M 
[SND]Диман Брюханов - Давай вкатаемся братан_(muzfan.net).mp32022-08-09 10:59 7.1M 
[SND]sed1.mp32022-08-09 10:58 0  
[SND]Liam1.mp32022-08-09 10:57 7.5M 
[SND]Mr. Credo - Медляк (CXNVTVS flip) (www.hotplayer.ru).mp32022-08-09 10:56 0  
[SND]ask.mp32022-08-09 10:56 0  
[SND]Randa3.mp32022-08-09 10:55 0  
[SND]SM.mp32022-08-09 10:55 3.0M 
[SND]Randa.mp32022-08-09 10:54 3.4M 
[SND]Chin-Giz - Ствол.mp32022-08-09 10:53 5.5M 
[SND]Need You Lyrics Ex Battalion ft Jroa.mp32022-08-09 10:50 0  
[SND]PLVTINUM Tarro Champagne Sunshine Lyrics British men do it best TikTok Song.mp32022-08-09 10:50 0  
[SND]mahika.mp32022-08-09 10:50 0  
[SND]tite.mp32022-08-09 10:49 0  
[SND]gamitin nang babae.mp32022-08-09 10:48 0  
[SND]The Walters I Love You So.mp32022-08-09 10:48 0  
[SND]Like A Virgin Lyrics Video Madonna.mp32022-08-09 10:48 0  
[SND]Aqua Barbie Girl.mp32022-08-09 10:47 0  
[SND]Lo Ki Manifest Official Music Video.mp32022-08-09 10:47 1.4M 
[SND]David3.mp32022-08-09 10:47 2.3M 
[SND]Philippine National Anthem Lupang Hinirang TLEN.mp32022-08-09 10:47 0  
[SND]PH.mp32022-08-09 10:44 0  
[SND]SPEEDY SOUNDS & ENTERTAINMENT PIANO MIX #003.mp32022-08-09 10:42 0  
[SND]Who's Lovin You.mp32022-08-09 10:40 0  
[SND]Tickle me pink.mp32022-08-09 10:39 0  
[SND]Lintik.mp32022-08-09 10:37 0  
[SND]sbw1.mp32022-08-09 10:36 0  
[SND]dgn1.mp32022-08-09 10:33 0  
[SND]y2mate.com - Juice WRLD The Weeknd Smile Official Video.mp32022-08-09 10:29 0  
[SND]joji_glimpse_of_us_1062941230036325777.mp32022-08-09 10:28 0  
[SND]djsalira.mp32022-08-09 10:28 0  
[SND]Joji-SLOW-DANCING-IN-THE-DARK_K3Qzzggn--s.mp32022-08-09 10:28 0  
[SND]before-I-close-my-eyes_2EpBqtqf8Go.mp32022-08-09 10:27 0  
[SND]y2mate.com - Juice WRLD Empty Official Audio.mp32022-08-09 10:27 0  
[SND]y2mate.com - Rich Brian Yellow ft Bekon Official Video.mp32022-08-09 10:27 0  
[SND]y2mate.com - Rich Brian Drive Safe Lyric Video.mp32022-08-09 10:26 0  
[SND]想見你.mp32022-08-09 10:22 1.8M 
[SND]atlanta.mp32022-08-09 10:19 4.4M 
[SND]beatgat1.mp32022-08-09 10:19 220K 
[SND]beatgat.mp32022-08-09 10:19 2.5M 
[SND]beat1.mp32022-08-09 10:19 2.3M 
[SND]morgenshtern-timati-el-problema-mp3.mp32022-08-09 10:16 5.3M 
[SND]trekkkk.mp32022-08-09 10:13 0  
[SND]alt-J - Breezeblocks (Lyrics).mp32022-08-09 10:11 0  
[SND]-_Pro_samp_rp_(Gybka.com).mp32022-08-09 10:09 0  
[SND]morgenshtern-eldzhej-cadillac-club-remix-by-skazka-music-mp3.mp32022-08-09 10:09 0  
[SND]lexzy3.mp32022-08-09 10:06 0  
[SND]sasageo.mp32022-08-09 10:05 0  
[SND]Ginn_Song_1.mp32022-08-09 10:02 0  
[SND]Ginn_Song_11.mp32022-08-09 10:01 0  
[SND]Ginn_Song_12.mp32022-08-09 10:01 0  
[SND]Ginn_Song_2.mp32022-08-09 10:01 0  
[SND]Ginn_Song_7.mp32022-08-09 09:59 0  
[SND]Ginn_Song_13.mp32022-08-09 09:59 0  
[SND]Miyagi, Andy Panda - Utopia (mp3day.net).mp32022-08-09 09:58 0  
[SND]Ginn_Song_6.mp32022-08-09 09:58 0  
[SND]Ginn_Song_9.mp32022-08-09 09:58 0  
[SND]Ginn_Song_4.mp32022-08-09 09:58 0  
[SND]FAJRIA.mp32022-08-09 09:57 0  
[SND]Ginn_Song_10.mp32022-08-09 09:57 0  
[SND]Ginn_Song_3.mp32022-08-09 09:56 0  
[SND]ganvest-durnaya-mp3.mp32022-08-09 09:56 0  
[SND]для мта 8 — военкомат (www.lightaudio.ru).mp32022-08-09 09:53 0  
[SND]Happy Asmara - Tatu [OFFICIAL].mp32022-08-09 09:53 0  
[SND]WOW.mp32022-08-09 09:51 0  
[SND]lexzy1.mp32022-08-09 09:49 0  
[SND]love3.mp32022-08-09 09:48 0  
[SND]hcdbf.mp32022-08-09 09:47 0  
[SND]Djpk1.mp32022-08-09 09:46 0  
[SND]Ебанько - Я ебу собак.mp32022-08-09 09:46 2.2M 
[SND]AUD-20220809-WA0308.mp32022-08-09 09:46 0  
[SND]efekgedhangkluthuk.mp32022-08-09 09:35 0  
[SND]qwe.mp32022-08-09 09:31 2.6M 
[SND]⛱ Travel Vlog No Copyright Chill Summer Background Music for Video _ Anywhere by shandr & Nick Perry (2).mp32022-08-09 09:31 0  
[SND]Ебанько - Еби меня.mp32022-08-09 09:30 0  
[SND]Ginn_Song_5.mp32022-08-09 09:30 0  
[SND]atme.mp32022-08-09 09:30 0  
[SND]phulu.mp32022-08-09 09:27 0  
[SND]AUD-20220809-WA0314.m4a2022-08-09 09:27 0  
[SND]remixx.mp32022-08-09 09:25 0  
[SND]duka.mp32022-08-09 09:23 5.1M 
[VID]sms.mp42022-08-09 09:19 78K 
[VID]GABUT2.mp42022-08-09 09:17 0  
[VID]GABUT1.mp42022-08-09 09:17 0  
[SND]india.mp32022-08-09 09:17 0  
[SND]dangdut3.mp32022-08-09 09:16 0  
[SND]dangdut2.mp32022-08-09 09:16 1.4M 
[SND]Baby.mp32022-08-09 09:15 2.0M 
[SND]gamora_-_bazaru_net_(z2.fm).mp32022-08-09 09:08 0  
[VID]VID-20220731-WA0012.mp42022-08-09 09:08 3.1M 
[SND]Dije2.mp32022-08-09 09:07 2.7M 
[VID]VID-20220724-WA0006.mp42022-08-09 09:07 0  
[SND]Joko tingkirr.mp32022-08-09 09:06 5.3M 
[SND]Awd1.mp32022-08-09 09:03 148K 
[SND]Asb1.mp32022-08-09 08:59 0  
[SND]CN - Atomwaffen Division.mp32022-08-09 08:56 0  
[SND]Brk1.mp32022-08-09 08:50 0  
[SND]bro2.mp32022-08-09 08:47 0  
[SND]Dd1.mp32022-08-09 08:47 0  
[SND]Gg33.mp32022-08-09 08:47 400K 
[SND]PANICX, SH3TLVIZ - Give Em Hell.mp32022-08-09 08:45 0  
[SND]Strom1.mp32022-08-09 08:44 0  
[SND]Music Cover l 66,We are Badguy,JAK Founder (RB Version).mp32022-08-09 08:42 0  
[SND]TBA.mp32022-08-09 08:38 0  
[SND]tose1.mp32022-08-09 08:36 0  
[SND]seto5.mp32022-08-09 08:31 0  
[SND]AZBest5.mp32022-08-09 08:21 0  
[SND]renz1.mp32022-08-09 08:21 0  
[SND]AZBest2.mp32022-08-09 08:21 0  
[SND]AZBest3.mp32022-08-09 08:21 0  
[SND]AZBest1.mp32022-08-09 08:21 0  
[SND]Debt Collection - Outbound - Follow-up call.mp32022-08-09 08:20 0  
[SND]AsiaZoneRPBest4.mp32022-08-09 08:19 0  
[SND]AsiaZoneRPBest2.mp32022-08-09 08:19 0  
[SND]AsiaZoneRPBest1.mp32022-08-09 08:19 0  
[SND]AsiaZoneRPBest5.mp32022-08-09 08:19 0  
[SND]AsiaZoneRPBest3.mp32022-08-09 08:18 0  
[SND]genggeng.mp32022-08-09 08:17 300K 
[SND]01 DJ CONRAY - HELLO SUMMER AMAPIANO MIX (1).mp32022-08-09 08:16 0  
[SND]gang.mp32022-08-09 08:12 0  
[SND]D42_3.mp32022-08-09 08:10 0  
[SND]vip3.mp32022-08-09 08:06 0  
[SND]D42_2.mp32022-08-09 08:05 0  
[SND]D42_1.mp32022-08-09 08:05 0  
[SND]laskarpelangi.mp32022-08-09 08:04 3.1M 
[SND]sabilulung.mp32022-08-09 08:03 2.6M 
[SND]yt1s.com - Breaking Bad Main Title Theme Extended.mp32022-08-09 08:03 0  
[SND]partyfavor.mp32022-08-09 08:01 3.7M 
[SND]vserana.mp32022-08-09 07:59 0  
[SND]DJ AINT MY FAULT SLOWED VIRAL TIK TOK TERBARU 2022 YANG KALIAN CARI .mp32022-08-09 07:58 2.3M 
[SND]D44.mp32022-08-09 07:57 232K 
[SND]DJ+TELOLET+BY+DJ+SOPAN.mp32022-08-09 07:55 0  
[SND]D42.mp32022-08-09 07:55 0  
[SND]bibo.mp32022-08-09 07:55 0  
[SND]lc.mp32022-08-09 07:55 0  
[SND]asede.mp32022-08-09 07:54 0  
[SND]serana.mp32022-08-09 07:53 0  
[SND]cium.mp32022-08-09 07:52 0  
[SND]sempurna.mp32022-08-09 07:50 4.0M 
[SND]love.mp32022-08-09 07:47 1.2M 
[SND]bentrentanglau.mp32022-08-09 07:46 0  
[SND]beauty.mp32022-08-09 07:44 0  
[SND]december.mp32022-08-09 07:42 3.3M 
[SND]kaso.mp32022-08-09 07:38 0  
[SND]loguo1.mp32022-08-09 07:37 2.4M 
[SND]MAXMENGKEREN.mp32022-08-09 07:37 451K 
[SND]xdhii1.mp32022-08-09 07:36 0  
[SND]7125391394302429978.mp32022-08-09 07:35 0  
[SND]MuthukaleIkkaethittund.mp32022-08-09 07:33 0  
[SND]xz.mp32022-08-09 07:31 3.2M 
[SND]co.mp32022-08-09 07:30 2.9M 
[SND]hmaz1.mp32022-08-09 07:29 3.8M 
[SND]AUD-20220729-WA0004.mp32022-08-09 07:28 209K 
[SND]flyme.mp32022-08-09 07:27 2.9M 
[VID]100.000.k_1659661158_musicaldown.com.mp42022-08-09 07:27 1.8M 
[SND]secretlove.mp32022-08-09 07:26 3.8M 
[SND]beachbunny1.mp32022-08-09 07:22 2.3M 
[SND]acabo.mp32022-08-09 07:19 8.1M 
[SND]na.mp32022-08-09 07:19 2.3M 
[SND]remix2.mp32022-08-09 07:18 4.5M 
[SND]kutahan.mp32022-08-09 07:17 1.2M 
[SND]Radita.mp32022-08-09 07:11 120K 
[SND]wonder.mp32022-08-09 07:08 2.7M 
[SND]slow.mp32022-08-09 07:08 1.2M 
[SND]phonk-killer-green-orxnge-madness_104015874.mp32022-08-09 07:03 0  
[SND]theshade.mp32022-08-09 06:59 1.9M 
[SND]Sidekick.mp32022-08-09 06:55 0  
[SND]tam2000.mp32022-08-09 06:54 0  
[SND]yss.mp32022-08-09 06:51 0  
[SND]y2mate.com - DJ SIKOK BAGI DUO REMIX PALEMBANG JEDAG JEDUG MENGKANE VIRAL TIKTOK (2).mp32022-08-09 06:43 0  
[SND]لحن حزين بدون كلمات 2021 - موسيقى حزينة تخليك تراجع أفعالك 💔.mp32022-08-09 06:42 0  
[SND]undertel.mp32022-08-09 06:39 0  
[SND]mxnarchNightwing.mp32022-08-09 06:38 0  
[SND]1630639076_fogel-bogatymi-2.mp32022-08-09 06:38 0  
[SND]bones-hdmi-chopped-and-screwed-by-hardhammi.mp32022-08-09 06:34 0  
[SND]Rock.mp32022-08-09 06:33 5.1M 
[SND]120080oon-120071eity-go_456240723.mp32022-08-09 06:32 0  
[SND]FindMyName - Show me your back.mp32022-08-09 06:31 0  
[SND]M.mp32022-08-09 06:31 2.4M 
[SND]xxxmanera-NeverBrokeAgain(musmore.com).mp32022-08-09 06:30 0  
[SND]Canon.mp32022-08-09 06:29 0  
[SND]taktau.mp32022-08-09 06:26 1.2M 
[SND]broker.mp32022-08-09 06:25 2.8M 
[SND]Lugowo.mp32022-08-09 06:22 8.4M 
[SND]y2mate.m4a2022-08-09 06:21 958K 
[SND]geng02.mp32022-08-09 06:20 2.6M 
[SND]geng01.mp32022-08-09 06:20 4.4M 
[SND]mix.mp32022-08-09 06:20 11M 
[VID]httpswww.mp42022-08-09 06:19 3.3M 
[SND]s8.mp32022-08-09 06:17 0  
[SND]Neo.mp32022-08-09 06:16 0  
[SND]DIL2.mp32022-08-09 06:14 0  
[SND]DIL1.mp32022-08-09 06:14 0  
[SND]DIL3.mp32022-08-09 06:14 0  
[SND]final_62f18d113ce3bf0066abf1b0_130277.mp32022-08-09 06:08 0  
[SND]prescriptionkid.mp32022-08-09 06:07 0  
[SND]Ito Ang Liga PBA.mp32022-08-09 06:07 0  
[SND]Djviraltt.mp32022-08-09 06:04 0  
[SND]dappam.mp3.mp32022-08-09 06:01 0  
[SND]die.mp32022-08-09 05:58 4.0M 
[SND]One.mp32022-08-09 05:56 4.2M 
[SND][lagu1s.com]TRICKSTER ANTHEM.oE6DQp1BAP8.mp32022-08-09 05:54 0  
[SND]Czerny op.849 no.1.mp32022-08-09 05:52 0  
[SND]teriak.mp32022-08-09 05:49 3.3M 
[SND]tipex.mp32022-08-09 05:46 2.7M 
[SND]ssstik_1652526939748.mp32022-08-09 05:46 0  
[SND]ssstik.io_1653374373576.mp32022-08-09 05:44 0  
[SND]ZentaMusicyea.mp32022-08-09 05:44 0  
[SND]Opasnyjj_-_Opasnyjj_khud_71073513.mp32022-08-09 05:43 0  
[SND]JEldzhi_-_Mojj_Rajjon_69081944.mp32022-08-09 05:42 0  
[SND]Sektor_Gaza_-_CHastushki_55189352.mp32022-08-09 05:38 7.7M 
[SND]s5.mp32022-08-09 05:33 3.8M 
[SND]the-smiths-the-boy-with-the-thorn-in-his-side.mp32022-08-09 05:32 0  
[SND]eldzhey-rastvoritel.mp32022-08-09 05:30 1.7M 
[SND]set12.mp32022-08-09 05:29 2.9M 
[SND]dreamgirl.mp32022-08-09 05:24 0  
[SND]cuy.mp32022-08-09 05:19 0  
[SND]ReZox8.mp32022-08-09 05:18 0  
[SND]WhereIsTheLove.mp32022-08-09 05:16 0  
[SND]seto3.mp32022-08-09 05:16 0  
[SND]DaEK4.mp32022-08-09 05:16 0  
[SND]seto2.mp32022-08-09 05:16 0  
[SND]Ton3.mp32022-08-09 05:15 0  
[SND]YraF5.mp32022-08-09 05:12 0  
[SND]Avtosh_-_Huligan_(iPleer.com).mp32022-08-09 05:11 0  
[SND]BRDYVV_-_Avtosh_Xuligan_66898732.mp32022-08-09 05:11 0  
[SND]Fw5X.mp32022-08-09 05:09 0  
[SND]SrAf5.m4a2022-08-09 05:05 0  
[SND]GARa4s.mp32022-08-09 05:01 0  
[SND]CYSec.mp32022-08-09 05:01 0  
[SND]ZhR24.mp32022-08-09 04:58 0  
[SND]dingincuy.mp32022-08-09 04:58 0  
[SND]SkrA5.mp32022-08-09 04:56 0  
[SND]LeeGa5.mp32022-08-09 04:53 0  
[SND]GaSt1.mp32022-08-09 04:51 0  
[SND]GaSt4.mp32022-08-09 04:49 0  
[SND]Ginn_Song_Lofi_HanyalahMimpi.mp32022-08-09 04:48 0  
[SND]Ginn_Song_Lofi_YangKuInginkan.mp32022-08-09 04:48 0  
[SND]Google.mp32022-08-09 04:48 0  
[SND]Ginn_Song_Yasobi_Daijobu.mp32022-08-09 04:48 0  
[SND]Ginn_Song_Gustixa_Kobbo.mp32022-08-09 04:47 0  
[SND]Ginn_Song_7_Orange.mp32022-08-09 04:47 0  
[SND]Ginn_Song_JKT48_FortuneCookie.mp32022-08-09 04:47 0  
[SND]Ginn_Song_JKT48_SemutMerah.mp32022-08-09 04:47 0  
[SND]Ginn_Song_Lofi_Bersamamu.mp32022-08-09 04:47 0  
[SND]Ginn_Song_Vierra_YangKuInginkan.mp32022-08-09 04:47 0  
[SND]Ginn_Song_Vierra_Seandainya.mp32022-08-09 04:47 0  
[SND]CYS01Q.mp32022-08-09 04:45 0  
[SND]CloseYEyes.mp32022-08-09 04:43 0  
[SND]Dayang23.mp32022-08-09 04:37 7.5M 
[SND]GaSt5.mp32022-08-09 04:36 5.9M 
[SND]Nightcore - Demons.mp32022-08-09 04:35 5.1M 
[SND](Extended) Llusion X Banakula - Midnight Sun (Ramzoid Remix).mp32022-08-09 04:33 9.2M 
[SND]Demi Lovato - Cool For The Summer [vzvuke.net].mp32022-08-09 04:33 0  
[SND]finikfinya__aleks_ataman_-_a_na_rukah_snezhinki_(z2.fm).mp32022-08-09 04:32 0  
[SND]fatbelly__abdr_-_bokal_(slowed_remix)_muzati.net.mp32022-08-09 04:28 0  
[SND]inbound2598099215265422569.mp32022-08-09 04:22 0  
[SND]BAGAIKAN LANGIT - POTRET Piano Cover (1).mp32022-08-09 04:21 0  
[SND]CYS.mp32022-08-09 04:17 0  
[SND]jdMga8.mp32022-08-09 04:15 0  
[SND]ftyuhbb.mp32022-08-09 04:14 0  
[SND]coli.mp32022-08-09 04:11 0  
[SND]Aga2Dj.mp32022-08-09 04:10 0  
[SND]gaR8f.mp32022-08-09 04:06 0  
[SND]united.mp32022-08-09 04:04 0  
[SND]Agazt2.mp32022-08-09 04:01 0  
[SND]XdaGa9.mp32022-08-09 03:58 0  
[SND]XdaGa1.mp32022-08-09 03:56 0  
[SND]GamonDek.mp32022-08-09 03:56 0  
[SND]pakwong.mp32022-08-09 03:51 4.3M 
[SND]indah.mp32022-08-09 03:50 3.7M 
[SND]secukupnya.mp32022-08-09 03:48 2.8M 
[SND]derixs.mp32022-08-09 03:48 0  
[SND]AgaRa3.mp32022-08-09 03:46 1.7M 
[SND]sai1.mp32022-08-09 03:45 0  
[SND]agS1r.mp32022-08-09 03:44 0  
[SND]KolxChill.mp32022-08-09 03:41 1.1M 
[SND]drumsbums.mp32022-08-09 03:40 2.3M 
[SND]elisha1.mp32022-08-09 03:39 404K 
[SND]ABRAM.mp32022-08-09 03:39 391K 
[SND]resah.mp32022-08-09 03:38 3.3M 
[SND]AgRa4f.mp32022-08-09 03:38 352K 
[SND]rumah.mp32022-08-09 03:35 2.2M 
[SND]AgaTs3.mp32022-08-09 03:34 0  
[SND]BXBXK.mp32022-08-09 03:31 0  
[SND]rain.mp32022-08-09 03:30 1.7M 
[SND]heaven.mp32022-08-09 03:29 5.4M 
[SND]AgaT3.mp32022-08-09 03:28 0  
[SND]Ma.mp32022-08-09 03:26 1.1M 
[SND]Mixx.mp32022-08-09 03:25 1.2M 
[SND]Thin.mp32022-08-09 03:25 1.5M 
[SND]KGF2.mp32022-08-09 03:24 0  
[SND]Ruth B. - Dandelions (Lyrics) slowed reverb (128 kbps) (YTmp3xd.com).mp32022-08-09 03:23 0  
[SND]ฉลามชอบงับคุณ - Bonnadol Feat IIVY B [ เนื้อเพลง ] (1).mp32022-08-09 03:23 2.9M 
[SND]Rafae2.mp32022-08-09 03:21 0  
[SND]LOW.mp32022-08-09 03:17 0  
[SND]malingakala.mp32022-08-09 03:16 156K 
[SND]Rafae1.mp32022-08-09 03:10 4.1M 
[SND]Uyirini Uyire.mp32022-08-09 02:49 0  
[SND]CRUMBY.mp32022-08-09 02:44 0  
[SND]ELMANANA.mp32022-08-09 02:29 0  
[SND]EARFQUAKE.mp32022-08-09 02:23 0  
[SND]Rage Music.mp32022-08-09 02:19 0  
[SND]Track_002.mp32022-08-09 02:11 0  
[SND]Track_001.mp32022-08-09 02:09 0  
[SND]PaperAwaySound.mp32022-08-09 02:03 0  
[SND]21.mp32022-08-09 01:57 88K 
[SND]vcy.mp32022-08-09 01:57 1.0M 
[SND]request14.mp32022-08-09 01:55 4.5M 
[SND]request42.mp32022-08-09 01:54 3.1M 
[SND]jackie.mp32022-08-09 01:49 1.5M 
[SND]TP.mp32022-08-09 01:49 0  
[SND]UN.mp32022-08-09 01:49 0  
[SND]UY.mp32022-08-09 01:48 5.8M 
[SND]charge it tho.mp32022-08-09 01:48 3.2M 
[SND]KM.mp32022-08-09 01:47 8.3M 
[SND]dandelions.mp32022-08-09 01:46 3.6M 
[SND]lemontree.mp32022-08-09 01:45 1.9M 
[SND]ET.mp32022-08-09 01:45 0  
[SND]EK.mp32022-08-09 01:45 0  
[SND]Paubaya.mp32022-08-09 01:38 0  
[SND]i.mp32022-08-09 01:29 2.8M 
[SND]ejpogi.mp32022-08-09 01:17 0  
[SND]Yowis.mp32022-08-09 01:16 0  
[SND]malam1.mp32022-08-09 01:08 1.0M 
[SND]keluh1.mp32022-08-09 01:04 0  
[SND]WizKid ft. Tems - Essence (Violin Cover) _ Tyler Butler-Figueroa.mp32022-08-09 01:00 0  
[SND]ajg.m4a2022-08-09 00:45 0  
[SND]Xe1.mp32022-08-09 00:34 0  
[SND]Caca.mp32022-08-09 00:30 4.3M 
[SND]Cep1.mp32022-08-09 00:29 0  
[SND]tapydi.mp32022-08-09 00:29 0  
[SND]dos0.mp32022-08-09 00:28 0  
[SND]keluhmalam.mp32022-08-09 00:27 0  
[SND]Cep.mp32022-08-09 00:24 0  
[SND]30.mp32022-08-09 00:22 88K 
[SND]yt1s.com - Ngaca dulu Woy ANJAR OXS FEAT RYAN RAP.mp32022-08-09 00:14 0  
[SND]jandaai.mp32022-08-09 00:13 0  
[SND]Final_Composition_without_the_blank_space.mp32022-08-09 00:04 0  
[SND]lfreda.mp32022-08-09 00:01 0  
[SND]paramuda.mp32022-08-08 23:38 0  
[SND]sepanjang.mp32022-08-08 23:37 0  
[SND]Young Star - Trap Da School [Prod. Steid Onee].mp32022-08-08 23:37 0  
[SND]polisiiii.mp32022-08-08 23:33 0  
[SND]djlegowo2.mp32022-08-08 23:33 0  
[SND]free-cyberpunk-music-no-copyright-inception.mp32022-08-08 23:20 0  
[SND]merovingian-vivaldi-2.mp32022-08-08 23:19 0  
[SND]TIKUS.mp32022-08-08 23:12 0  
[SND]VITO1.mp32022-08-08 23:11 0  
[SND]polisiiiii.mp32022-08-08 23:06 2.7M 
[SND]Bicycle.m4a2022-08-08 22:43 1.1M 
[SND]START.mp32022-08-08 22:35 0  
[SND]AMIE's Voice Cover #956876.mp32022-08-08 22:33 0  
[SND]Warriyo - Mortals (feat. Laura Brehm) [NCS Release].mp32022-08-08 22:28 596K 
[SND]C.mp32022-08-08 22:28 525K 
[SND]Andy Panda feat. Miyagi - Endorphin.mp32022-08-08 22:24 0  
[SND]Zeann3.mp32022-08-08 22:06 0  
[SND]Zeann4.mp32022-08-08 22:05 0  
[SND]Zeann2.mp32022-08-08 22:04 0  
[SND]Zeann1.mp32022-08-08 22:04 0  
[SND]playamane-nateki-midnight-mp3.mp32022-08-08 22:02 0  
[SND]KSLV_Noh_-_Override_(musmore.com).mp32022-08-08 22:01 0  
[SND]E.mp32022-08-08 21:54 6.2M 
[SND]D.mp32022-08-08 21:54 3.8M 
[SND]yt1s.com - Chikh Mourad Alik Hna Ki Dayrin Remix.mp32022-08-08 21:39 0  
[SND]vitalyaigraetvbrawlstars.mp32022-08-08 21:36 3.1M 
[SND]Arabic Remix - Ya Lili Samet Koban Remix.mp32022-08-08 21:33 0  
[SND]RS16.mp32022-08-08 21:31 0  
[SND]ralph01.mp3.mp32022-08-08 21:28 0  
[SND]1605779284_lyube-davay-za.mp32022-08-08 21:22 0  
[VID]Disem za tebe.mp42022-08-08 21:20 840K 
[SND]Tat1.mp32022-08-08 21:16 0  
[SND]closee1.mp32022-08-08 21:15 0  
[SND]- — Атака титанов (opening 1) (www.lightaudio.ru).mp32022-08-08 21:13 0  
[SND]kevin.mp32022-08-08 21:10 0  
[SND]ralph01.mp32022-08-08 21:09 0  
[SND]22 Track22.mp32022-08-08 21:09 0  
[SND]21 Track21.mp32022-08-08 21:09 0  
[SND]19 Track19.mp32022-08-08 21:08 0  
[SND]17 Track17.mp32022-08-08 21:08 0  
[SND]11 Track11.mp32022-08-08 21:07 0  
[SND]18 Track18.mp32022-08-08 21:07 0  
[SND]MENGSADVIBES.mp32022-08-08 21:07 2.5M 
[SND]15 Track15.mp32022-08-08 21:06 0  
[SND]KANEGES.mp32022-08-08 21:06 4.8M 
[SND]Bro.mp32022-08-08 21:06 5.1M 
[SND]14 Track14.mp32022-08-08 21:06 0  
[SND]16 Track16.mp32022-08-08 21:06 0  
[SND]Maxxx.mp32022-08-08 21:06 0  
[SND]ralph1.mp32022-08-08 21:05 0  
[SND]Max.mp32022-08-08 21:05 136K 
[SND]07 Track07.mp32022-08-08 21:05 0  
[SND]09 Track09.mp32022-08-08 21:05 0  
[SND]12 Track12.mp32022-08-08 21:05 0  
[SND]10 Track10.mp32022-08-08 21:04 0  
[SND]08 Track08.mp32022-08-08 21:04 0  
[SND]02 Track02.mp32022-08-08 21:04 0  
[SND]05 Track05.mp32022-08-08 21:03 0  
[SND]03 Track03.mp32022-08-08 21:03 0  
[SND]01 Track01.mp32022-08-08 21:03 0  
[SND]04 Track04.mp32022-08-08 21:02 0  
[SND]06 Track06.mp32022-08-08 21:02 0  
[SND]01 CD 1 Track 1- Das Känguru Von Gegenüber.mp32022-08-08 21:01 0  
[SND]Abc2.mp32022-08-08 20:57 0  
[SND]Abc.mp32022-08-08 20:53 0  
[SND]haz.mp32022-08-08 20:50 0  
[SND]h8-hood-phantom-mp3.mp32022-08-08 20:46 0  
[SND]Виктор Цой - Перемен Phonk Edition (mp3-2020.com).mp32022-08-08 20:45 2.3M 
[SND]tian3.mp32022-08-08 20:44 0  
[SND]tian4.mp32022-08-08 20:43 0  
[SND]RAINING.mp32022-08-08 20:40 0  
[SND]Колибри.mp32022-08-08 20:36 0  
[SND]Hensonn_-_Omega_(musmore.com).mp32022-08-08 20:31 0  
[SND]чёрные глаза (Kanatbek Remix.mp32022-08-08 20:29 0  
[SND]xxxmanera_-_Never_Broke_Again_(musmore.com).mp32022-08-08 20:21 0  
[SND]YAMAUGLI_-_TARANTINO_69906617.mp32022-08-08 20:20 0  
[SND]Ghostemane - Blood Oceans (ft. Pharaoh).mp32022-08-08 20:19 0  
[SND]U.mp32022-08-08 20:18 0  
[SND]S.mp32022-08-08 20:18 0  
[SND]G.mp32022-08-08 20:18 2.1M 
[SND]jambrut ultah.mp32022-08-08 20:17 938K 
[SND]Ветер.mp32022-08-08 20:12 0  
[SND]SnapSave.io - Wind (128 kbps).mp32022-08-08 20:09 0  
[SND]99sido.mp32022-08-08 20:08 0  
[VID]Killa.mp42022-08-08 20:07 0  
[VID]Wind.mp42022-08-08 20:07 0  
[SND]Killa.mp32022-08-08 20:03 0  
[SND]wind.mp32022-08-08 20:03 0  
[SND]Killer8055.mp32022-08-08 20:01 0  
[SND]A.L.A - LVL 10 (Official Video).mp32022-08-08 20:00 0  
[SND]Akeboshi - wind.mp32022-08-08 19:59 0  
[SND]Sido9.mp32022-08-08 19:57 0  
[SND]pentap2.mp32022-08-08 19:57 0  
[SND]SIDO99.mp32022-08-08 19:56 0  
[SND]pentap1.mp32022-08-08 19:55 0  
[SND]penta6.mp32022-08-08 19:53 0  
[SND]penta8.mp32022-08-08 19:53 0  
[SND]penta9.mp32022-08-08 19:53 0  
[SND]penta7.mp32022-08-08 19:53 0  
[SND]penta4.mp32022-08-08 19:53 252K 
[SND]penta5.mp32022-08-08 19:53 0  
[SND]penta3.mp32022-08-08 19:52 0  
[SND]Nintendo - Mama ama criminal.mp32022-08-08 19:52 0  
[SND]dewa16.mp32022-08-08 19:51 0  
[SND]dewa14.mp32022-08-08 19:51 0  
[SND]dewa13.mp32022-08-08 19:51 0  
[SND]dewa15.mp32022-08-08 19:51 0  
[SND]penta1.mp32022-08-08 19:51 0  
[SND]penta2.mp32022-08-08 19:51 0  
[SND]dewa8.mp32022-08-08 19:49 3.3M 
[SND]dewa11.mp32022-08-08 19:49 0  
[SND]dewa12.mp32022-08-08 19:49 0  
[SND]dewa7.mp32022-08-08 19:49 0  
[SND]dewa10.mp32022-08-08 19:49 0  
[SND]MAKAVELIGODD, Haarper, Baker Ya Maker - Reaper Death Seal.mp32022-08-08 19:46 0  
[SND]FOVLA - BRODYAGA [6SIX].mp32022-08-08 19:45 0  
[SND]nong85544aom.mp32022-08-08 19:45 0  
[SND]Lil Wretched, polyGOD, Baker Ya Maker - SOUTHERN SAVIORS.mp32022-08-08 19:44 0  
[SND]SLKillinOnDemand.mp32022-08-08 19:43 0  
[SND]Dita Redrum - FOLLOW THE NIGHT.mp32022-08-08 19:42 0  
[SND]CAIN - RVN THE MOON.mp32022-08-08 19:41 7.4M 
[SND]SL - Killin' On Demand.mp32022-08-08 19:40 0  
[SND]LOMEO.mp32022-08-08 19:38 0  
[SND]xcho-i-can-fly.mp32022-08-08 19:38 0  
[SND]Miyagi_-_Samurajj_(musmore.com).mp32022-08-08 19:37 0  
[SND]xcho-feat-macan-memories.mp32022-08-08 19:37 0  
[SND]xcho-gangster.mp32022-08-08 19:37 0  
[SND]hity-2020-miyagi-amp-andy-panda-kosandra(mp3mir.ru) (1) - копия.mp32022-08-08 19:37 0  
[SND]miyagi-amp-andy-panda-tam-reveli-gory(mp3mir.ru).mp32022-08-08 19:37 0  
[SND]xcho-listok.mp32022-08-08 19:37 0  
[SND]miyagi-amp-andy-panda-minor(mp3mir.ru).mp32022-08-08 19:37 0  
[SND]hity-2020-miyagi-amp-andy-panda-kosandra(mp3mir.ru) (1).mp32022-08-08 19:37 0  
[SND]Jamik_-_Rodnojj_dom_(musmore.com).mp32022-08-08 19:36 0  
[SND]Jamik - Авторитеты.mp32022-08-08 19:36 0  
[SND]Jamik - Не Побывал.mp32022-08-08 19:36 0  
[SND]Jamik - Не Просто.mp32022-08-08 19:36 0  
[SND]Jamik - Май.mp32022-08-08 19:36 0  
[SND]Jamik - Молили Небеса.mp32022-08-08 19:36 0  
[SND]Rustam_Abrekov_Solnce_vshodit_i_zahodit_a_v_moej_tyurme_temno_remiks.mp32022-08-08 19:36 0  
[SND]PPZ.mp32022-08-08 19:31 0  
[VID]SnapTik_7128737615418772762.mp42022-08-08 19:27 0  
[SND]VotreDésirEstVotreOrdre_CD09.mp32022-08-08 19:19 0  
[SND]VotreDésirEstVotreOrdre_CD10.mp32022-08-08 19:19 0  
[SND]VotreDésirEstVotreOrdre_CD13.mp32022-08-08 19:18 0  
[SND]VotreDésirEstVotreOrdre_CD14.mp32022-08-08 19:18 0  
[SND]VotreDésirEstVotreOrdre_CD12.mp32022-08-08 19:18 0  
[SND]LiSA - Akeboshi -TV ver._(MP3Ball.ru).mp32022-08-08 19:17 0  
[SND]Kendrick_Lamar_MC_Eiht_-_mAAd_city_48211143.mp32022-08-08 19:17 0  
[SND]Sektor_Gaza_-_Bomzh_55189317.mp32022-08-08 19:16 0  
[SND]Samuel Kim Music - Demon Slayer_ Akeboshi (LiSA) x Rengoku vs Akaza Theme EPIC VERSION (Mugen Train OP).mp32022-08-08 19:16 0  
[SND]GIN Niveau 01 Allemagne 1a.mp32022-08-08 19:15 0  
[SND]GIN Niveau 01 Allemagne 1c.mp32022-08-08 19:15 0  
[SND]GIN Niveau 01 Allemagne 1b.mp32022-08-08 19:15 0  
[SND]GIN Niveau 01 Allemagne 1d.mp32022-08-08 19:15 0  
[SND]GIN Niveau 01 Zurich 1b.mp32022-08-08 19:15 0  
[SND]GIN Niveau 01 Zurich 1a.mp32022-08-08 19:15 0  
[SND]GIN Niveau 01 Zurich 1c.mp32022-08-08 19:14 0  
[SND]GIN_Niveau_1_Patton_sur_l-art_de_diriger_03.mp32022-08-08 19:14 0  
[SND]GIN_Niveau_1_Patton_sur_l-art_de_diriger_02.mp32022-08-08 19:14 0  
[SND]GIN_Niveau_1_Patton_sur_l-art_de_diriger_04.mp32022-08-08 19:14 0  
[SND]KTS 1-2.mp32022-08-08 19:14 0  
[SND]KTS 1-1.mp32022-08-08 19:14 0  
[SND]KTS 2-1.mp32022-08-08 19:13 0  
[SND]KTS 2-2.mp32022-08-08 19:13 0  
[SND]KTS 3-1.mp32022-08-08 19:13 0  
[SND]LiSA_-_Akeboshi_Demon_Slayer_Mugen_Train_OP_(BiffHard.click).mp32022-08-08 19:11 0  
[SND]pesnya-a-ya-vse-zhil-tumanami-gorod-byl-obmanom.mp32022-08-08 19:11 0  
[SND]lv_0_20220808215941.mp32022-08-08 19:10 1.0M 
[SND]fabdou.mp32022-08-08 19:10 2.2M 
[SND]dewa5.mp32022-08-08 19:09 4.8M 
[SND]dewa6.mp32022-08-08 19:09 4.9M 
[SND]dewa4.mp32022-08-08 19:09 4.4M 
[SND]FREEAGAREB.mp32022-08-08 19:06 0  
[SND]Santiz_Daleko_za_zakatom_my_ya_tyanu_etot_sladkij_dym.mp32022-08-08 19:04 6.4M 
[SND]2021.11.17_LiSA_-_Akeboshi_-Instrumental-_Akeboshi_Shirogane_(BiffHard.click).mp32022-08-08 18:59 10M 
[SND]dewa3.mp32022-08-08 18:59 3.4M 
[SND]dewa2.mp32022-08-08 18:58 3.7M 
[SND]VitalyaBrawlStars.mp32022-08-08 18:58 0  
[SND]dewa1.mp32022-08-08 18:56 5.1M 
[SND]eto-novyi-bravl-stars.mp32022-08-08 18:56 0  
[SND]DR_VODKA_KOKAINA.mp32022-08-08 18:54 0  
[SND]AUD-20220719-WA0002.mp32022-08-08 18:54 1.3M 
[SND]Kobo1.mp32022-08-08 18:54 369K 
[SND]LiSA — Akeboshi (OST Клинок рассекающий демонов Demon Slayer Kimetsu no Yaiba Movie_ Mugen Ressha-hen) (www.lightaudio.ru).mp32022-08-08 18:53 0  
[SND]LiSA_-_Akeboshi_73333662 (1).mp32022-08-08 18:52 0  
[SND]name.mp32022-08-08 18:51 2.6M 
[SND]baji.mp32022-08-08 18:51 0  
[SND]NYU_-_Nikto_73298145.mp32022-08-08 18:51 0  
[SND]ice.mp32022-08-08 18:50 0  
[SND]LiSA_-_Akeboshi_73333662.mp32022-08-08 18:44 0  
[SND]yad_dobra_-_dzhaman_(feat._marcus_tenshi)_muzati.net.mp32022-08-08 18:43 0  
[SND]LiSA - Akeboshi.mp32022-08-08 18:42 0  
[SND]mlk1.mp32022-08-08 18:41 0  
[SND]LiSA_-_Akeboshi_(musmore.com).mp32022-08-08 18:41 0  
[SND]azashin.mp32022-08-08 18:37 0  
[SND]LiSA-Akeboshi.mp32022-08-08 18:35 0  
[SND]Galau9.mp32022-08-08 18:35 0  
[SND]Eyedress - Jealous (1).mp32022-08-08 18:35 4.7M 
[SND]azashin1.mp32022-08-08 18:34 0  
[SND]Tesr.mp32022-08-08 18:34 0  
[SND]LiSA_-_Gurenge_(musmore.com).mp32022-08-08 18:33 0  
[SND]hllgod_granitnoe_izdelie_(muzebra.top).mp32022-08-08 18:33 0  
[SND]KANDA.mp32022-08-08 18:32 0  
[SND]SODA_LUV_-_Bljess_gad_72465406.mp32022-08-08 18:30 5.9M 
[SND]You2.mp32022-08-08 18:27 0  
[SND]o re piya lutu.mp32022-08-08 18:27 0  
[SND]Malaak.mp32022-08-08 18:25 0  
[SND]DINDA.mp32022-08-08 18:23 0  
[SND]KRBK - 24.mp32022-08-08 18:21 0  
[SND]Dinda.mp32022-08-08 18:15 0  
[SND]You.mp32022-08-08 18:11 2.1M 
[SND]autdrp.mp32022-08-08 18:09 0  
[SND]The Beach.mp32022-08-08 17:59 3.5M 
[SND]Ineedyourmachinegun.mp32022-08-08 17:57 0  
[SND]I need your machine gun.mp32022-08-08 17:56 0  
[SND]kv.mp32022-08-08 17:56 0  
[SND]Sound_Yang_Lagi_Viral_Di_Tiktok_RIZKI._SZ!!!_Dj_Jang_-_Oon_B_(Bootleg)_-_[Raka_Remixer_FT_Dj_Prolal](256k).mp32022-08-08 17:54 0  
[SND]AUD-20220804-WA0052.mp32022-08-08 17:53 0  
[SND]SOUND_VIRAL_TIKTOK!!!_Dj_Mojang_Priangan_Mengkane_(Bootleg)(256k).mp32022-08-08 17:53 0  
[SND]Sound_Yang_Lagi_Viral_Di_TikTok_Rizki.Sz!!!_Dj_Midua_Cinta_Mengkane!!!_(Bootleg)_-_Raka_Remixer(256k).mp32022-08-08 17:51 0  
[SND]Ollu.mp32022-08-08 17:50 0  
[SND]fox6.mp32022-08-08 17:49 0  
[SND]Vald PAM PAM PAM.mp32022-08-08 17:48 0  
[SND]lui5.mp3.mp32022-08-08 17:48 0  
[SND]anna-sedokova-shantaram(mp3gid.me).mp32022-08-08 17:48 0  
[SND]sn.mp32022-08-08 17:45 0  
[SND]original sound - valorantforge.store_1659980472_musicaldown.com.mp32022-08-08 17:45 0  
[SND]MORGENSHTERN_Aarne_-_DALEKO_74571235.mp32022-08-08 17:44 5.7M 
[SND]snte20.mp32022-08-08 17:43 0  
[SND]snte23.mp32022-08-08 17:43 0  
[SND]snte22.mp32022-08-08 17:43 0  
[SND]snte21.mp32022-08-08 17:43 0  
[SND]snte18.mp32022-08-08 17:43 0  
[SND]LP2022MEGAMIX-demo.mp32022-08-08 17:43 0  
[SND]MengunduH.mp32022-08-08 17:40 0  
[SND]KemalPaklepi.mp32022-08-08 17:37 0  
[SND]Fenn6.mp32022-08-08 17:34 0  
[SND]SipalingHamil.mp32022-08-08 17:32 0  
[SND]MomSetahe.mp32022-08-08 17:30 0  
[SND]Wreireto.mp32022-08-08 17:29 0  
[SND]AyunaLayangan.mp32022-08-08 17:29 0  
[SND]24 - Blues+Shuffle+in+A.mp32022-08-08 17:27 0  
[SND]icalSad.mp32022-08-08 17:27 0  
[SND]01 Inspirabeat.mp32022-08-08 17:24 0  
[SND]raider1.mp32022-08-08 17:24 0  
[SND]Dheera (1).mp32022-08-08 17:24 0  
[SND]06 Almost Lover.mp32022-08-08 17:23 0  
[SND]Slow4.mp32022-08-08 17:20 0  
[SND]Slow2.mp32022-08-08 17:19 0  
[SND]Slow1.mp32022-08-08 17:19 0  
[SND]AND.mp32022-08-08 17:18 0  
[SND]raider2.mp32022-08-08 17:17 0  
[SND]raider3.mp32022-08-08 17:16 0  
[SND]Dark Royalty Core Classical Music.mp32022-08-08 17:16 0  
[SND]jojii.mp32022-08-08 17:14 0  
[SND]Dying Light 2 Stay Human OST Soundtrack 2 There is Hope.mp32022-08-08 17:13 0  
[SND]Barat5.mp32022-08-08 17:07 0  
[SND]y2mate.com - you make me strongOne direction Speed upaudio edit Viral Tiktok.mp32022-08-08 17:00 0  
[SND]dj enak.mp32022-08-08 16:59 2.6M 
[SND]1603828375_pesnya_barmane_baba_.mp32022-08-08 16:58 0  
[SND]song free fire max makin hd (BUENAMUSICA.NET).mp32022-08-08 16:55 0  
[SND]LOVEE.mp32022-08-08 16:51 0  
[SND]Jancuk1.mp32022-08-08 16:50 0  
[SND]Testt.mp32022-08-08 16:50 0  
[SND]IND.mp32022-08-08 16:48 3.6M 
[SND]BRM.mp32022-08-08 16:44 0  
[SND]Mareux — The Perfect Girl (www.lightaudio.ru) (1).mp32022-08-08 16:43 0  
[SND]Gw1.mp32022-08-08 16:42 0  
[SND]Via Amilcare Cucchini.m4a2022-08-08 16:42 0  
[SND]Tipo.mp32022-08-08 16:42 0  
[SND]Jancuk.mp32022-08-08 16:41 2.1M 
[SND]yanto.mp32022-08-08 16:41 3.0M 
[SND]AZIZOS____KIMA_CHAFCHA_(Clip_Officiel)(MP3_70K).mp32022-08-08 16:41 0  
[SND]Mareux — The Perfect Girl (www.lightaudio.ru).mp32022-08-08 16:40 0  
[SND]kv2.mp32022-08-08 16:40 0  
[SND]Zary.mp32022-08-08 16:37 0  
[SND]bentuk_cinta.mp32022-08-08 16:36 0  
[SND]Zara.mp32022-08-08 16:34 0  
[SND]D42 - Lannert - Mist der Typ hat eine Kamera vorm Haus.mp32022-08-08 16:34 0  
[SND]League of Legends & Mako - Piercing Light.mp32022-08-08 16:31 0  
[SND]IIRP.mp32022-08-08 16:28 0  
[SND]06082022.mp32022-08-08 16:26 0  
[SND]-- _ قلب المرأة يوسع بس لشخص واحد(MP3_128K).mp32022-08-08 16:23 0  
[SND]Said Energizer - Chicki.mp32022-08-08 16:23 0  
[SND]boki13.mp32022-08-08 16:23 0  
[SND]SandStorm-Portwave - Shadow Lady -phonk--kissvk.com.mp32022-08-08 16:22 0  
[SND]utopia.mp32022-08-08 16:15 0  
[SND]VinKy7.mp32022-08-08 16:10 3.5M 
[SND]AUD-20220808-WA0008.mp32022-08-08 15:58 0  
[SND]Miyagi & Эндшпиль feat. Рем Дигга - I Got Love.mp32022-08-08 15:54 0  
[SND]Two Two Two - Video Song _ Kaathuvaakula Rendu Kaadhal _ Vijay Sethupathi _ Anirudh _ Vignesh Shivan.mp32022-08-08 15:42 0  
[SND]Exit.mp32022-08-08 15:41 0  
[SND]BMW.mp32022-08-08 15:40 2.6M 
[SND]dodol.mp32022-08-08 15:38 3.7M 
[SND]before-you-go-lyrics.mp32022-08-08 15:35 3.2M 
[SND]bod.mp32022-08-08 15:33 0  
[SND]lucetod2.mp32022-08-08 15:30 952K 
[SND]ms13v20.mp32022-08-08 15:29 0  
[SND]Layar2.mp32022-08-08 15:27 4.0M 
[SND]Com7.mp32022-08-08 15:27 5.0M 
[SND]lucetod1.mp32022-08-08 15:26 0  
[SND]Ton1.mp32022-08-08 15:25 0  
[SND]RFiYou.mp32022-08-08 15:25 0  
[SND]Battle for Camelot.mp32022-08-08 15:23 0  
[SND]van1.mp32022-08-08 15:22 1.7M 
[SND]sweetchild.mp32022-08-08 15:21 3.5M 
[SND]Ligaw.mp32022-08-08 15:21 900K 
[SND]ilham6.mp32022-08-08 15:19 2.0M 
[SND]van.mp32022-08-08 15:19 0  
[SND]HB.mp32022-08-08 15:18 2.9M 
[SND]main1.mp32022-08-08 15:18 0  
[SND]kiyo6.mp32022-08-08 15:18 0  
[SND]Ishan10.mp32022-08-08 15:17 0  
[SND]Kordhell - Killers from northside ringtone __ [ Download link 👇] __ PIXEL BGM.mp32022-08-08 15:17 0  
[SND]niel1.mp32022-08-08 15:16 0  
[SND]ilham8.mp32022-08-08 15:16 0  
[SND]Die For You X บุญผลา (เทสไมค์) Die For you ของ พี่ไมค์ ภิรมย์พร #mashup.mp32022-08-08 15:15 0  
[SND][THAISUB] It's You - Ali Gatie.mp32022-08-08 15:15 0  
[SND]Anam2.mp32022-08-08 15:13 0  
[SND]2Pac - Hit 'Em Up (Dirty) (Music Video) HD.mp32022-08-08 15:06 0  
[SND]Battle Against A True Hero.mp32022-08-08 15:06 0  
[SND]ถ้าเธอรักใครคนหนึ่ง Ost บุพเพสันนิวาส ๒ เรียนเปียโนง่ายๆโน๊ตตัวใหญ่ดูง่่าย.mp32022-08-08 15:06 3.3M 
[SND]Banyo.mp32022-08-08 15:05 3.3M 
[SND]Dj11.mp32022-08-08 15:03 0  
[SND]down.mp32022-08-08 15:03 3.2M 
[SND]SICKO MODE.mp32022-08-08 15:03 0  
[SND]Whish.mp32022-08-08 15:02 0  
[SND]Anam1.mp32022-08-08 15:01 0  
[SND]big-baby-tape-kizaru-99-problems-mp3.mp32022-08-08 15:00 6.1M 
[SND]Liam25.mp32022-08-08 14:58 0  
[SND]Some.mp32022-08-08 14:52 0  
[SND]Indonesiaraya-gprp.mp32022-08-08 14:52 0  
[SND]Hall.mp32022-08-08 14:52 0  
[SND]Andrew.mp32022-08-08 14:51 1.9M 
[SND]once.mp32022-08-08 14:50 5.6M 
[SND]GOU.mp32022-08-08 14:50 816K 
[SND]EMPILIGHT.mp32022-08-08 14:49 3.1M 
[SND]Киря Насваев - Матиз (mp3by.net).mp32022-08-08 14:48 0  
[SND]FanzMahesa.mp32022-08-08 14:47 0  
[SND]bugoy.mp32022-08-08 14:43 2.7M 
[SND]AAA.mp32022-08-08 14:41 338K 
[SND]Pu.mp32022-08-08 14:41 0  
[SND]V1.mp32022-08-08 14:39 0  
[SND]Dandelions.mp32022-08-08 14:39 4.5M 
[SND]daur - Жалобы.mp32022-08-08 14:39 0  
[SND]trickster.mp32022-08-08 14:35 2.2M 
[SND]TRICKSTER ANTHEM (Official Music Video).mp32022-08-08 14:33 0  
[SND]Grammp3.mp32022-08-08 14:32 0  
[SND]indonesiaraya-glory-pride-roleplay1.mp32022-08-08 14:32 0  
[SND]Jacky Chang - Pero Atik Ra (Official Music Video).mp32022-08-08 14:32 0  
[SND]Daur_-_ZHaloby_72782377 (1).mp32022-08-08 14:31 0  
[SND]sed2.mp32022-08-08 14:30 0  
[SND]Cd11.mp32022-08-08 14:27 0  
[SND]TattooIN_-_Vne_sistemy_74518729.mp32022-08-08 14:27 0  
[SND]indie.mp32022-08-08 14:26 4.8M 
[SND]drums.mp32022-08-08 14:26 0  
[SND]niel.mp32022-08-08 14:24 2.4M 
[SND]ANAS.mp32022-08-08 14:24 0  
[SND]Romance.mp32022-08-08 14:24 3.5M 
[SND]hihiha.mp32022-08-08 14:23 0  
[SND]Ton2.mp32022-08-08 14:22 1.2M 
[SND]Main.mp32022-08-08 14:22 1.7M 
[SND]Mari.mp32022-08-08 14:21 1.3M 
[SND]Dip.mp32022-08-08 14:21 1.2M 
[SND]Ton.mp32022-08-08 14:21 0  
[SND]Cd1.mp32022-08-08 14:21 0  
[SND]Djku1.mp32022-08-08 14:19 152K 
[SND]CHABAH1.mp32022-08-08 14:18 4.3M 
[SND]Quasiteilchen (DJ Cannabis Coffeeshops Deutschland).mp32022-08-08 14:16 0  
[SND]wizykontol.mp32022-08-08 14:14 0  
[SND]salira.mp32022-08-08 14:14 24K 
[SND]indonesiaraya-glory-pride-roleplay-samp.mp32022-08-08 14:14 0  
[SND]Jalal El Hamdaoui - La Tenssayna Lyom (Audio 03 - With Lyrics)(MP3_70K) (درجة الصوت 0.44 - سرعة إيقاع 99).mp32022-08-08 14:14 0  
[VID]bandicam 2022-08-08 21-06-43-582.mp42022-08-08 14:12 0  
[SND]MONS - Lovini(MP3_320K).mp32022-08-08 14:11 0  
[SND]Antod3.mp32022-08-08 14:10 0  
[SND]Antod2.mp32022-08-08 14:10 0  
[SND]Antod1.mp32022-08-08 14:10 0  
[SND]15.mp32022-08-08 14:09 1.7M 
[SND]indonesiaraya-glory-pride-roleplay.mp32022-08-08 14:06 0  
[SND]fdhgsdfhg.mp32022-08-08 14:05 0  
[SND]PeroAtikRa.mp32022-08-08 14:04 0  
[SND]Kommunalki_pepelnica_dyrki_v_oboyah_92FLOWERS.mp32022-08-08 14:02 0  
[SND]7116127237098818330.mp32022-08-08 13:58 372K 
[SND]14.mp32022-08-08 13:56 88K 
[SND]Тархун_mz — ГРЕЧА С ХУNЦАМИ (www.lightaudio.ru).mp32022-08-08 13:56 0  
[SND]nilapakshi.mp32022-08-08 13:46 3.1M 
[SND]Powfu1.mp32022-08-08 13:46 0  
[SND]DEV1.mp32022-08-08 13:46 0  
[SND]Ali Ssamid - WALLAH _Official Music Video_ Prod.Valentino(MP3_320K).mp32022-08-08 13:45 0  
[SND]DEV2.mp32022-08-08 13:45 0  
[SND]𝖜𝖊𝖆𝖐𝖓𝖊𝖘𝖘 - Самур.mp32022-08-08 13:43 2.0M 
[SND]SaveTik_Net-dani-sylvia_08-08-22_22-15-41-381.mp32022-08-08 13:43 530K 
[SND]beer.mp32022-08-08 13:41 0  
[SND]Miyagi and Andy Panda - Патрон_(audiohunter.ru).mp32022-08-08 13:40 0  
[SND]Miyagi feat. KADI - Родная пой_(audiohunter.ru).mp32022-08-08 13:38 0  
[SND]Pero Atik Ra - Jacky Chang (Bisaya cover feat. 3RD AVENUE) ♡_ Morissette(MP3_128K).mp32022-08-08 13:29 2.6M 
[SND]Sad2.mp32022-08-08 13:28 888K 
[SND]Pero Atik Ra - Jacky Chang (Bisaya cover feat. 3RD AVENUE) ♡_ Morissette(MP3_160K).mp32022-08-08 13:22 2.1M 
[SND]y2mate.com - Hijau Daun Sesuatu Yang Sempurna Official Video Clip Musik.mp32022-08-08 13:19 0  
[SND]Sama.mp32022-08-08 13:18 4.7M 
[SND]genit1.mp32022-08-08 13:07 0  
[SND]FINIK_ALEKS_ATAMAN_-_YUra_SHatunov_74053794.mp32022-08-08 13:02 0  
[SND]Воскресенский - Плохое поведение.mp32022-08-08 13:01 0  
[SND]Воскресенский - Девочка.mp32022-08-08 13:01 0  
[SND]XOLIDAYBOY - ЧЁРНОЕ ВИНО.mp32022-08-08 13:01 0  
[SND]Sagath feat. HEARTSNOW - По пятам.mp32022-08-08 13:01 0  
[SND]Sagath feat. HEARTSNOW - По пятам (1).mp32022-08-08 13:01 0  
[SND]Overlust - Горесть Моя.mp32022-08-08 13:01 0  
[SND]GGG - MORGENSHTERN Hermit (Bass Gostmane style).mp32022-08-08 13:01 0  
[SND]Kisah Sempurna - Mahalini Lirik udah di potong.mp32022-08-08 12:59 0  
[SND]Imagination -Shawn Mendes (lyrics).mp32022-08-08 12:53 0  
[SND]lamar.mp32022-08-08 12:51 0  
[SND]kontol.mp32022-08-08 12:31 252K 
[SND]BELI GROUP-Music-productions - BELI GROUP ANTHEM BEAT .m4a2022-08-08 12:30 0  
[SND]rsc.mp32022-08-08 12:30 0  
[SND]VIP121.mp32022-08-08 12:29 0  
[SND]PL.mp32022-08-08 12:26 2.9M 
[SND]nkeeei-uniqe-artem-shilovets-feat-mayot-u-u-u.mp32022-08-08 12:25 0  
[SND]gg.mp32022-08-08 12:25 2.8M 
[SND]like.mp32022-08-08 12:23 0  
[SND]awis.mp32022-08-08 12:23 0  
[SND]Ezhemesyachnye_-_tolko_po_duri_69601880.mp32022-08-08 12:23 0  
[SND]Jamie_Bower_-_Paralysed_Live_From_The_Alter[ConverteZilla.com].mp32022-08-08 12:20 0  
[SND]Merbabu02.mp32022-08-08 12:18 1.4M 
[SND]pantek.mp32022-08-08 12:17 2.0M 
[SND]Dalam-Sepiku-Kaulah-Candaku-Rendy-Andika-ft-Mita-Mpot-Cintaku-DJ-Topeng-Remix_9dzyhPzTIfk.mp32022-08-08 12:16 2.0M 
[SND]paimon1.mp32022-08-08 12:11 0  
[SND]Cinta.mp32022-08-08 12:11 0  
[SND]Pengen.mp32022-08-08 12:09 0  
[SND]LUNAR.mp32022-08-08 12:08 0  
[SND]viyi.mp32022-08-08 12:07 0  
[SND][YT2mp3 (mp3cut.net).mp32022-08-08 12:07 0  
[SND]ssstik.io_1659960016912.mp32022-08-08 12:03 0  
[SND]Ungol.mp32022-08-08 12:02 1.0M 
[SND]LeftRight.mp32022-08-08 12:02 0  
[SND]Fefe.mp32022-08-08 12:01 0  
[SND]Wasted.mp32022-08-08 12:01 0  
[SND]All Type A Drugs.mp32022-08-08 11:59 0  
[SND]Gg.mp32022-08-08 11:59 500K 
[SND]RianR1mex.mp32022-08-08 11:58 0  
[SND]wint.mp32022-08-08 11:57 0  
[SND]slp.mp32022-08-08 11:57 0  
[SND]Fallin.mp32022-08-08 11:57 0  
[SND]TimPogi.mp32022-08-08 11:56 0  
[SND]JO.mp32022-08-08 11:51 0  
[SND]Calvin Harris, Dua Lipa - One Kiss (Lyrics).mp32022-08-08 11:50 0  
[SND]Subway Surfers — Game Theme (www.lightaudio.ru).mp32022-08-08 11:50 0  
[SND]Subway_Surfers_-_OST_Glavnaya_tema_73599365.mp32022-08-08 11:49 0  
[SND]Ida Hauan med oppdateringer mandag.mp32022-08-08 11:48 0  
[SND]WIBOY15.mp32022-08-08 11:45 0  
[SND]1555931844_unknown-brain-matafaka-feat_-marvin-divine.mp32022-08-08 11:43 0  
[SND]angkasa1.mp32022-08-08 11:42 0  
[SND]Slipknot - Psychosocial.mp32022-08-08 11:34 0  
[SND]Slipknot - Surfacing.mp32022-08-08 11:34 0  
[SND]oomb.mp32022-08-08 11:34 0  
[SND]Stahlmann - Hass mich.lieb mich.mp32022-08-08 11:34 0  
[SND]Slipknot - People = Shit (1).mp32022-08-08 11:34 0  
[SND]Slipknot - (sic).mp32022-08-08 11:34 0  
[SND]Modjo - Lady (1).mp32022-08-08 11:34 0  
[SND]Rammstein - DU HAST.mp32022-08-08 11:34 0  
[SND]Rammstein - Feuer frei.mp32022-08-08 11:34 0  
[SND]Nervana - Smells Like Teen Spint.mp32022-08-08 11:34 0  
[SND]20 Fingers feat. Gillette - Short Dick Man (Club Mix).mp32022-08-08 11:34 0  
[SND]im so lucky lucky - lucky twice ☆.mp32022-08-08 11:34 0  
[SND]Bloodhound Gang - I Hope You Die.mp32022-08-08 11:34 0  
[SND]Fazlija - Helikopter.mp32022-08-08 11:34 0  
[SND]KSLV Noh - Disaster.mp32022-08-08 11:34 3.2M 
[SND]Black Pug - Seven Nation Army (Metal Cover).mp32022-08-08 11:34 0  
[SND]GRLwood - Nice Guy.mp32022-08-08 11:33 0  
[SND]3-bigg-balls-By-Tuna.mp32022-08-08 11:33 0  
[SND]ah-hell-nah-By-Tuna.mp32022-08-08 11:33 0  
[SND]GOTUSO.mp32022-08-08 11:29 0  
[SND]close.mp32022-08-08 11:29 0  
[SND]y2mate.com - cover viral Last Child Duka cover bashri.mp32022-08-08 11:26 0  
[SND]BryanD07.mp32022-08-08 11:26 0  
[SND]HERO.mp32022-08-08 11:25 3.0M 
[SND]DJ_MIDUA.mp32022-08-08 11:20 0  
[SND]hot42.mp32022-08-08 11:17 0  
[SND]hot50.mp32022-08-08 11:16 0  
[SND]DJMIDUA.mp32022-08-08 11:16 0  
[SND]nguyenthanhhoang.mp32022-08-08 11:15 0  
[SND]kelazzz.mp32022-08-08 11:11 0  
[SND]Dj100.mp32022-08-08 11:11 2.9M 
[SND]the-chainsmokers-feat.-daya-dont-let-me-down.mp32022-08-08 11:10 0  
[SND]gaullin-moonlight.mp32022-08-08 11:10 0  
[SND]Rakhim - Fendi.mp32022-08-08 11:10 0  
[SND]the-chainsmokers-coldplay-something-just-like-this.mp32022-08-08 11:10 0  
[SND]ed-sheeran-shape-of-you.mp32022-08-08 11:10 0  
[SND]mozgi-poljubje.mp32022-08-08 11:10 0  
[SND]Big_Baby_Tape_Arut_Vlaga.mp32022-08-08 11:10 0  
[SND]I_tried_so_hard_(ringon.site).mp32022-08-08 11:10 0  
[SND]MACAN_Kino.mp32022-08-08 11:10 0  
[SND]dabro-ja-po-chasticam.mp32022-08-08 11:10 0  
[SND]topic-feat.-a7s-breaking-me.mp32022-08-08 11:10 0  
[SND]sia-chandelier.mp32022-08-08 11:10 0  
[SND]tiesto-sevenn-boom.mp32022-08-08 11:10 0  
[SND]Unknown Brain - Superhero (feat. Chris Linton)_(muzfan.net).mp32022-08-08 11:10 0  
[SND]gaullin-julian-perretta-seven-nation-army.mp32022-08-08 11:10 0  
[SND]Tanir, Tyomcha - Da Da Da.mp32022-08-08 11:10 0  
[SND]tyga_-_ayy_macarena_muzter.net.mp32022-08-08 11:10 0  
[SND]drenchill-feat.-indiiana-freed-from-desire.mp32022-08-08 11:10 0  
[SND]rita-ora-let-you-love-me.mp32022-08-08 11:10 0  
[SND]vera-brezhneva-blizkie-ljudi.mp32022-08-08 11:10 0  
[SND]imagine-dragons-thunder.mp32022-08-08 11:10 0  
[SND]Kaleo_-_Way_down_we_go_(ringon.site).mp32022-08-08 11:10 0  
[SND]the-chainsmokers-feat.-emily-warren-side-effects.mp32022-08-08 11:10 0  
[SND]tones-and-i-dance-monkey.mp32022-08-08 11:10 0  
[SND]minelli-rampampam.mp32022-08-08 11:10 2.1M 
[SND]Velya_с4.mp32022-08-08 11:10 0  
[SND]Лауд - My Life My Rules (feat. Boulevard Depo, i61).mp32022-08-08 11:10 0  
[SND]SEDIH3.mp32022-08-08 11:09 0  
[SND]My Chemical Romance - I'm Not Okay (I Promise) [Dialogue_MTV Version].mp32022-08-08 11:07 0  
[SND]IERN.mp32022-08-08 11:06 0  
[SND]SEDIH1.mp32022-08-08 11:04 1.0M 
[SND]Love.mp32022-08-08 11:04 3.9M 
[SND]the-prince-karma-later-bitches.mp32022-08-08 11:03 0  
[SND]the-kid-laroi-feat.-justin-bieber-stay.mp32022-08-08 11:03 0  
[SND]egor-krid-cosmoboy-pubg-mobile-theme-song-file.mp32022-08-08 11:03 0  
[SND]enrique-iglesias-feat.-descemer-bueno-jacob-forever-subeme-la-radio-remix.mp32022-08-08 11:03 0  
[SND]rasa-feat.-kavabanga-depo-kolibri-fioletovo.mp32022-08-08 11:03 0  
[SND]foushee-deep-end-rompasso-remix.mp32022-08-08 11:03 0  
[SND]christina-aguilera-genie-in-a-bottle.mp32022-08-08 11:03 0  
[SND]maksim-fadeev-grigorijj-leps-orly-ili-vorony.mp32022-08-08 11:03 0  
[SND]egor-krid-amp-molly-esli-ty-menja-ne-ljubish.mp32022-08-08 11:03 0  
[SND]trevor-daniel-falling-blackbear-remix.mp32022-08-08 11:03 0  
[SND]Luis Fonsi - Despacito (Version Pop).mp32022-08-08 11:03 0  
[SND]dnce-feat.-nicki-minaj-kissing-strangers.mp32022-08-08 11:03 0  
[SND]filv-edmofo-feat.-emma-peters-clandestina.mp32022-08-08 11:03 0  
[SND]griby-niga-ne-goni.mp32022-08-08 11:03 0  
[SND]ofenbach-be-mine.mp32022-08-08 11:03 0  
[SND]NEFFEX_-_Fight-Back.mp32022-08-08 11:02 0  
[SND]irina-dubcova-fakt.mp32022-08-08 11:02 0  
[SND]valerijj-meladze-svoboda-ili-sladkijj-plen.mp32022-08-08 11:02 0  
[SND]114-AN-NAAS.mp32022-08-08 11:01 0  
[SND]106-QURESH.mp32022-08-08 11:01 0  
[SND]113-AL-FALAQ.mp32022-08-08 11:01 0  
[SND]111-AL-LAHAB.mp32022-08-08 11:01 0  
[SND]112-AL-IKHLAAS.mp32022-08-08 11:01 0  
[SND]105-AL-FEEL.mp32022-08-08 11:01 0  
[SND]104-AL-HUMAZAH.mp32022-08-08 11:01 0  
[SND]109-AL-KAFIROON.mp32022-08-08 11:01 0  
[SND]110-AN-NASR.mp32022-08-08 11:01 0  
[SND]107-AL-MAA'OON.mp32022-08-08 11:01 0  
[SND]108-AL-KAUSER.mp32022-08-08 11:01 0  
[SND]103-AL-ASR.mp32022-08-08 11:01 0  
[SND]101-AL-QAAR'IAH.mp32022-08-08 11:01 0  
[SND]102AT-TAKASUR.mp32022-08-08 11:01 0  
[SND]aziyat.mp32022-08-08 11:01 0  
[SND]084-AL-INSHIQAAQ.mp32022-08-08 11:01 0  
[SND]099-AZ-ZILZAAL.mp32022-08-08 11:00 0  
[SND]100-AL-ADIAAT.mp32022-08-08 11:00 0  
[SND]096-AL-ALAQ.mp32022-08-08 11:00 0  
[SND]Tak Ingin Usai – Keisya Levronka (KARAOKE PIANO - FEMALE LOWER KEY).mp32022-08-08 11:00 0  
[SND]094-AL-INSHIRAH.mp32022-08-08 11:00 0  
[SND]089-AL-FAJR.mp32022-08-08 11:00 0  
[SND]093-AZ-ZUHAA.mp32022-08-08 11:00 0  
[SND]097-Al-QADR.mp32022-08-08 11:00 0  
[SND]095-AT-TEEN.mp32022-08-08 11:00 0  
[SND]087-AL-A'LAA.mp32022-08-08 11:00 0  
[SND]090-AL-BALAD.mp32022-08-08 11:00 0  
[SND]088-AL-GHASHIAH.mp32022-08-08 11:00 0  
[SND]085-AL-BUROOJ.mp32022-08-08 11:00 0  
[SND]083-AL-MUTTAFFIFEEN.mp32022-08-08 11:00 0  
[SND]086-AT-TARIQ.mp32022-08-08 11:00 0  
[SND]079-AN-NAZI'AAT.mp32022-08-08 11:00 0  
[SND]081-AT-TAKWEER.mp32022-08-08 11:00 0  
[SND]064-AT-TAGHABUN.mp32022-08-08 11:00 0  
[SND]082-AL-INFITAAR.mp32022-08-08 11:00 0  
[SND]075-AL-QIYAAMAH.mp32022-08-08 11:00 0  
[SND]Joji.mp32022-08-08 11:00 0  
[SND]076-AD-DAHR.mp32022-08-08 11:00 0  
[SND]065-AT-TALAAQ.mp32022-08-08 11:00 0  
[SND]072-AL-JINN.mp32022-08-08 10:59 0  
[SND]073-AL-MUZZAMMIL.mp32022-08-08 10:59 0  
[SND]063-AL-MUNAFIQOON.mp32022-08-08 10:59 0  
[SND]071-NOOH.MP.mp32022-08-08 10:59 0  
[SND]068-AL-QALAM.mp32022-08-08 10:59 0  
[SND]070-AL-MA'ARIJ.mp32022-08-08 10:59 0  
[SND]069-AL-HAAQ-QAH.mp32022-08-08 10:59 0  
[SND]067-AL-MULK.mp32022-08-08 10:59 0  
[SND]066-AT-TAHREEM.mp32022-08-08 10:59 0  
[SND]061-AS-SAFF.mp32022-08-08 10:59 0  
[SND]062-AL-JUMU'AH.mp32022-08-08 10:59 0  
[SND]Lil Peep-Runaway.mp32022-08-08 10:59 0  
[SND]Rp1.mp32022-08-08 10:59 0  
[SND]GIBO.mp32022-08-08 10:58 0  
[SND]057-AL-HADEED.mp32022-08-08 10:57 0  
[SND]060-AL-MUMTAHINAH.mp32022-08-08 10:57 0  
[SND]iChoose.mp32022-08-08 10:57 0  
[SND]054-AL-QAMAR.mp32022-08-08 10:57 0  
[SND]059-AL-HASHR.mp32022-08-08 10:57 0  
[SND]056-AL-WAQI'AH.mp32022-08-08 10:56 0  
[SND]055-AR-RAHMAN.mp32022-08-08 10:56 0  
[VID]lil peep x lil tracy - witchblades (Official Video).mp42022-08-08 10:56 0  
[SND]051-AZ-ZARIYAAT.mp32022-08-08 10:55 0  
[SND]041-HAA MEEM AS-SAJDAH.mp32022-08-08 10:55 0  
[SND]043-AZ-ZUKHRUF.mp32022-08-08 10:55 0  
[SND]044-AD-DUKHAN.mp32022-08-08 10:54 0  
[SND]046-AL-AHQAAF.mp32022-08-08 10:53 0  
[SND]033-AL-AHZAB.mp32022-08-08 10:51 0  
[SND]040-AL-MO'MIN.mp32022-08-08 10:51 0  
[SND]036-YAA SEEN.mp32022-08-08 10:51 0  
[SND]038-SUAD.MP.mp32022-08-08 10:51 0  
[SND]039-AZ-ZUMAR.mp32022-08-08 10:51 0  
[SND]037-AS-SAFFAAT.mp32022-08-08 10:50 0  
[SND]031-LUQMAN.mp32022-08-08 10:50 0  
[SND]029-AL-ANKABOOT.mp32022-08-08 10:49 0  
[SND]030-AR-ROOM.mp32022-08-08 10:49 0  
[SND]028-AL-QASES.mp32022-08-08 10:49 0  
[SND]025-AL-FURQAN.mp32022-08-08 10:48 0  
[SND]024-AN-NOOR.mp32022-08-08 10:48 0  
[SND]027-AN-NAML.mp32022-08-08 10:48 0  
[SND]Y2K & Bbnos - Lalala.mp32022-08-08 10:46 0  
[SND]RASA - Пчеловод.mp32022-08-08 10:46 6.5M 
[SND]lp-other-people-swanky-tunes-going-deeper-remix.mp32022-08-08 10:46 0  
[SND]psy-gangnam-style.mp32022-08-08 10:46 0  
[SND]raye-feat.-rudimental-regardless.mp32022-08-08 10:46 0  
[SND]mjevl-patamushka.mp32022-08-08 10:46 0  
[SND]022-AL-HAJJ.mp32022-08-08 10:46 0  
[SND]karna-val-psihushka-mp3.mp32022-08-08 10:46 0  
[SND]majnkraft-evgenbro-ty-ne-mog-ma-ya-smog.mp32022-08-08 10:46 0  
[SND]kyz9ka - Хаги Ваги.mp32022-08-08 10:46 0  
[SND]SHOOVAL - Мы открываем бизнес (1).mp32022-08-08 10:46 0  
[SND]023-AL-MO'MINOON.mp32022-08-08 10:46 0  
[SND]Konfuz - Ратата.mp32022-08-08 10:46 0  
[SND]Slava Marlow - Снова Я Напиваюсь.mp32022-08-08 10:46 0  
[SND]SLAVA MARLOW - Ты горишь как огонь.mp32022-08-08 10:46 0  
[SND]Rakhim - Кто Тебе Сказал.mp32022-08-08 10:45 0  
[SND]The Supremes_ Love Is Like an Itching in My Heart (Holland _ Dozier, 1966) - Lyrics.mp32022-08-08 10:45 0  
[SND]019-MARYAM.mp32022-08-08 10:44 0  
[SND]020-TAA HAA.mp32022-08-08 10:43 0  
[SND]DJ SLOW YA CUMA KAMU X YOU MAKE ME FEEL _ VIRAL TIKTOK 2022.mp32022-08-08 10:42 0  
[SND]Rp.mp32022-08-08 10:42 3.6M 
[SND]017-BANI ISRAIL [036 TO End].mp32022-08-08 10:40 0  
[SND]012-YOUSUF.mp32022-08-08 10:40 0  
[SND]014-IBRAHEEM.mp32022-08-08 10:40 0  
[SND]017-BANI ISRAIL [001 TO 035].mp32022-08-08 10:40 0  
[SND]016-AN-NAHL [001 TO 065].mp32022-08-08 10:40 0  
[SND]Веля - с4.mp32022-08-08 10:40 0  
[SND]016-AN-NAHL [066 TO End].mp32022-08-08 10:40 0  
[SND]anikdote-turn-it-up_37662143.mp32022-08-08 10:40 0  
[SND]Bag_Raiders_-_Shooting_Stars.mp32022-08-08 10:40 0  
[SND]calvin-harris-sam-smith-promises.mp32022-08-08 10:40 0  
[SND]charlie-puth-attention.mp32022-08-08 10:40 0  
[SND]1654711070_spvbrtvnkrbl.mp32022-08-08 10:40 0  
[SND]benny-benassi-feat-dhany-hit-my-heart.mp32022-08-08 10:40 0  
[SND]013-AR-RA'AD.mp32022-08-08 10:40 0  
[SND]5sta-family-mnogojetazhki.mp32022-08-08 10:40 0  
[SND]Нурминский - Ауфф.mp32022-08-08 10:40 0  
[SND]DaBro - Юность.mp32022-08-08 10:40 0  
[SND]Dava feat. Серёга - Черный Бумер.mp32022-08-08 10:40 0  
[SND]Тайпан feat. Agunda - Луна Не Знает Пути.mp32022-08-08 10:39 0  
[SND]Сява - Без Повода.mp32022-08-08 10:39 0  
[SND]Нурминский - Валим.mp32022-08-08 10:39 0  
[SND]Lana Del Rey - Burnt Norton (Interlude).mp32022-08-08 10:39 0  
[SND]002-AL-BAQARAH (001 TO 029).mp32022-08-08 10:38 0  
[SND]002-AL-BAQARAH [229 TO 253].mp32022-08-08 10:38 0  
[SND]002-AL-BAQARAH [197 TO 228].mp32022-08-08 10:38 0  
[SND]002-AL-BAQARAH [108 TO 141].mp32022-08-08 10:38 0  
[SND]002-AL-BAQARAH [177 TO 196].mp32022-08-08 10:38 0  
[SND]Save.mp32022-08-08 10:38 0  
[SND]002-AL-BAQARAH (030 TO 046).mp32022-08-08 10:37 8.1M 
[SND]002-AL-BAQARAH [142 TO 176].mp32022-08-08 10:37 10M 
[SND]002-AL-BAQARAH [047 TO 074].mp32022-08-08 10:37 10M 
[SND]002-AL-BAQARAH [075 TO 107].mp32022-08-08 10:37 10M 
[SND]001-AL-FAATIHAH.mp32022-08-08 10:35 0  
[SND]Hal-L-Official-Audio_xAFKlDjKO5o (1).mp32022-08-08 10:35 0  
[SND]hujan.mp32022-08-08 10:35 1.7M 
[SND]yt5s.io - The Supremes_ Love Is Like an Itching in My Heart (Holland _ Dozier, 1966) - Lyrics (128 kbps).mp32022-08-08 10:34 0  
[SND]002-AL-BAQARAH [254 TO End].mp32022-08-08 10:33 0  
[SND]stars.mp32022-08-08 10:30 0  
[SND]mulixneed.mp32022-08-08 10:30 0  
[SND]mashupkago.mp32022-08-08 10:29 0  
[SND]mashicov.mp32022-08-08 10:29 0  
[SND]lagimashup.mp32022-08-08 10:29 0  
[SND]gimelove.mp32022-08-08 10:29 0  
[SND]castle.mp32022-08-08 10:29 0  
[SND]byahecover.mp32022-08-08 10:29 0  
[SND]yt5s.io - Bee Gees - Spirits (Having Flown) (128 kbps).mp32022-08-08 10:27 0  
[SND]X2Download.app - เป็นเกียรติหลาย - มนต์แคน แก่นคูน 【MUSIC VIDEO】 (128 kbps).mp32022-08-08 10:26 940K 
[SND]last_friday_night___TikTok_Version___speed_up____lyrics_.(128k).m4a2022-08-08 10:25 0  
[SND]And_so_it_was.mp32022-08-08 10:25 0  
[SND]SEDIH.mp32022-08-08 10:19 4.0M 
[SND]BYFARID.mp32022-08-08 10:18 0  
[SND]kakaobelogo (1).mp32022-08-08 10:16 0  
[SND]Aishite Aishite Aishite (English Cover)【Will Stetson】.mp32022-08-08 10:13 0  
[SND]y2mate.com - DJ AKU TITIPKAN DIA X SIA SIAKU BERJUANG DIRANTAU ORANG REMIX VIRAL TIKTOK ALBUM 2021 (1).mp32022-08-08 10:12 0  
[SND]luckyy.mp32022-08-08 10:12 0  
[SND]07 Aug 2022 Mix By Veli.mp32022-08-08 10:11 0  
[SND]Instasamka_-_KHlopajj_Christmas_Tik_Tok_reMix_73378106.mp32022-08-08 10:08 0  
[SND]lucky.mp32022-08-08 10:03 2.2M 
[SND]never.mp32022-08-08 09:59 1.0M 
[SND]rizky.mp32022-08-08 09:53 4.5M 
[SND]brk1.mp32022-08-08 09:52 0  
[SND]Alireza-JJ-Sijal-Pir-Shodim-Vali-Bozorg-Na-(Ft-Nassim)-320 (mp3cut.net).mp32022-08-08 09:50 0  
[SND]tegarganz.mp32022-08-08 09:49 0  
[SND]Cheb Hasni - aachk jdid.mp32022-08-08 09:47 0  
[SND]bro1.mp32022-08-08 09:46 0  
[SND]sikfiling.mp32022-08-08 09:46 0  
[SND]broker1.mp32022-08-08 09:44 0  
[SND]bayu1.mp32022-08-08 09:42 3.1M 
[SND]Mackenzie Ziegler - Breathe (Lyrics) _So breathe, like you know you should_.mp32022-08-08 09:42 0  
[SND]Yums5.mp32022-08-08 09:41 0  
[SND]Yums4.mp32022-08-08 09:41 0  
[SND]Yums3.mp32022-08-08 09:40 0  
[SND]Simpleng Tao Lyrics - Gloc 9.mp32022-08-08 09:40 0  
[SND]shyrah.mp32022-08-08 09:40 0  
[SND]yam2.mp32022-08-08 09:38 0  
[SND]Lontongenak1.mp32022-08-08 09:34 2.7M 
[SND]ram1.mp32022-08-08 09:33 3.3M 
[SND]Pasukan1.mp32022-08-08 09:32 0  
[SND]dhije100.mp32022-08-08 09:27 0  
[SND]Yums2.mp32022-08-08 09:25 0  
[SND]Yums1.mp32022-08-08 09:22 0  
[SND]Insane.mp32022-08-08 09:20 0  
[SND]starboy.mp32022-08-08 09:20 0  
[SND]o5.mp32022-08-08 09:18 4.0M 
[SND]Gloc 9 Greatest Hits Full Album 2020 - Best Of Gloc 9 Nonstop - Gloc 9 Band Greatest Hits (128 kbps).mp32022-08-08 09:17 0  
[SND]neandro.mp32022-08-08 09:16 1.4M 
[SND]Yo1.mp32022-08-08 09:14 8.2M 
[SND]Bruno Mars - When I Was Your Man (Video Lirik) _ John Legend, Sam Smith,....mp32022-08-08 09:12 488K 
[SND]fugy99.mp32022-08-08 09:11 0  
[SND]y2mate.com - Kevin MacLeod BEST OF Best known music by Kevin MacLeod.mp3.mp32022-08-08 09:10 0  
[SND]ROAD_DEVILS_MC'S_-_Prod_By_MANGBORIS_(Official_Audio)(128k).mp32022-08-08 09:08 3.2M 
[SND]Peri_Cintaku_-_Ziva_Magnolya_(Lirik_Lagu)_~_TikTok_Viral_Tuhan_memang_satu,_kita_yang_tak_sama..(128k).mp32022-08-08 09:04 4.1M 
[SND]YELLOWEEN_-_TOKIO_x_BASO_x_PAFF_x_EITARO_(Official_Music_Video)(128k).mp32022-08-08 09:04 3.2M 
[SND]HEJOBOYS_(OFFICIAL_MUSIC_VIDEO)(128k).mp32022-08-08 09:03 3.3M 
[SND]GHO_FAM_-_Prod_By._MANGBORIS_(Official_Audio)(128k).mp32022-08-08 09:03 1.9M 
[SND]Ezra4.mp32022-08-08 09:02 5.0M 
[SND]MeerFly_-_%22HAA_TEPOK%22_(Ft._MK_|_K-Clique_&_Kidd_Santhe)_[OFFICIAL_LYRICS_VIDEO](128k).mp32022-08-08 09:02 3.4M 
[SND]rof12.mp32022-08-08 09:00 6.7M 
[SND]Caleb Landry Jones - Im On Top of the World.mp32022-08-08 09:00 3.8M 
[SND]Vp9 .mp32022-08-08 08:59 2.9M 
[SND]ajm.mp32022-08-08 08:59 2.8M 
[SND]Ezra3.mp32022-08-08 08:57 4.9M 
[SND]6ix9ine-gooba-official-music-video.mp32022-08-08 08:56 0  
[SND]Caleb Landry Jones - Suckin' Up The Oxygen.mp32022-08-08 08:54 528K 
[SND]phonk1.mp32022-08-08 08:54 2.1M 
[SND]boy1.mp32022-08-08 08:51 0  
[SND]letter.mp32022-08-08 08:48 2.9M 
[SND]ikaw.mp32022-08-08 08:48 4.0M 
[SND]crad.mp32022-08-08 08:48 0  
[SND]drugs.mp32022-08-08 08:47 0  
[SND]humble.mp32022-08-08 08:47 0  
[SND]todd.mp32022-08-08 08:42 0  
[SND]Moneyso.mp32022-08-08 08:41 0  
[SND]abubu.mp32022-08-08 08:40 0  
[SND]Syava_-_Ne_blatujj_73187272.mp32022-08-08 08:37 0  
[SND]Syava_-_YA_drochu_kak_ya_khochu_48245395.mp32022-08-08 08:36 0  
[SND]genjer genjer cu.mp32022-08-08 08:28 0  
[SND]Face-Pull UP.mp32022-08-08 08:23 0  
[SND]warzz.mp32022-08-08 08:21 828K 
[SND]Solomon Islandz Slow MuZyker ft Madrid DJ - [ReGGae Babes] Malapoa Golden Jubilee Live Show RiddiM.mp32022-08-08 08:20 4.7M 
[VID]Y2Mate.is - HARDSTYLE 2021 December Mix [ hardstyle mix 132 ]-gvIGrIEkqms-720p-1659906308424.mp42022-08-08 08:11 0  
[SND]Frontliner - Keep It Up.mp32022-08-08 08:11 0  
[SND]maafkanaku.mp32022-08-08 08:06 0  
[SND]comeon.mp32022-08-08 07:57 5.3M 
[SND]Arab.mp32022-08-08 07:54 0  
[SND]Tom Odell - Another Love (Official Video).mp32022-08-08 07:52 0  
[SND]Крошка моя, я по тебе скучаю - Руки Вверх (Tik tok) (1).mp32022-08-08 07:51 0  
[SND]WGAU-AM - Weekday Evening Drive - MF 7p12a - Cox Media Athens.mp32022-08-08 07:50 0  
[SND]empiremix.mp32022-08-08 07:48 0  
[SND]DJtiaraSAD.mp32022-08-08 07:47 0  
[SND]Asem.mp32022-08-08 07:47 393K 
[SND]CLOSE EYES.mp3.mp32022-08-08 07:43 0  
[SND]DEVIL.mp32022-08-08 07:42 2.4M 
[SND]It_is_realme.mp32022-08-08 07:41 0  
[SND]galau10.mp32022-08-08 07:40 0  
[SND]Ronald.mp32022-08-08 07:39 0  
[SND]UjangKanjut.mp32022-08-08 07:39 3.5M 
[SND]oombal.mp32022-08-08 07:38 0  
[SND]tothemoon.mp32022-08-08 07:36 0  
[SND]arawan.mp32022-08-08 07:36 0  
[SND]abow.mp32022-08-08 07:36 0  
[SND]Cabi.mp32022-08-08 07:35 0  
[SND]Kesari2.mp32022-08-08 07:31 0  
[SND]Paa Sa Lupa - Pilyo Gang Ft. JCF.mp32022-08-08 07:30 0  
[SND]The Shapes Song.mp32022-08-08 07:30 0  
[SND]Dalam-Sepiku-Kaulah-Candaku.mp32022-08-08 07:30 0  
[SND]Dalam-Sepiku-Kaulah-Candaku-Rendy-Andika-ft-Mita-Mpot-Cintaku-DJ-Topeng-Remix_9dzyhPzTIfk (mp3cut.net).mp32022-08-08 07:28 0  
[SND]pipi.mp32022-08-08 07:28 0  
[SND]usai.mp32022-08-08 07:26 3.4M 
[SND]Candaku.mp32022-08-08 07:26 0  
[SND]Dalam-Sepiku-Kaulah-Candaku-Rendy-Andika-ft-Mita-Mpot-Cintaku-DJ-Topeng-Remix_9dzyhPzTIfk (mp3cut.net) (1).mp32022-08-08 07:25 0  
[SND]Hello.mp32022-08-08 07:24 0  
[SND]DJ 1.mp32022-08-08 07:23 0  
[SND]Dalam sepiku kaulah candaku.mp32022-08-08 07:21 0  
[SND]Cintaku1.mp32022-08-08 07:19 0  
[SND]Toyang.mp32022-08-08 07:19 0  
[SND]hal.mp32022-08-08 07:18 2.4M 
[SND]Djnyaman0.mp32022-08-08 07:18 0  
[SND]Cintaku.mp32022-08-08 07:18 0  
[SND]runtuh2.mp32022-08-08 07:17 0  
[SND]bangunselfie.mp32022-08-08 07:17 0  
[SND]Dia.mp32022-08-08 07:16 0  
[SND]sikok.mp32022-08-08 07:15 4.6M 
[SND]Casablanca.mp32022-08-08 07:14 436K 
[SND]Eraserheads - Toyang.mp32022-08-08 07:13 0  
[SND]2rbina 2rista - Бабадук.mp32022-08-08 07:13 0  
[SND]kopilam.mp32022-08-08 07:12 0  
[SND]DK - Я Тут.mp32022-08-08 07:12 52K 
[SND]snap.mp32022-08-08 07:06 0  
[SND]bow.mp32022-08-08 07:01 0  
[SND]sunro.mp32022-08-08 06:56 0  
[SND]mo.mp32022-08-08 06:56 0  
[SND]nuha_bahrin_naufal_azrin_casablanca_official_music_video_8845422238622974089 (mp3cut.net) (1).mp32022-08-08 06:53 0  
[SND]Bk6Fh4.mp32022-08-08 06:49 0  
[SND]dakara.mp32022-08-08 06:46 0  
[SND]Con.mp32022-08-08 06:43 0  
[SND]mp3-now.com - One Piece Overtaken 720p HD.mp32022-08-08 06:43 0  
[SND]TD.mp32022-08-08 06:40 0  
[SND]24kGoldn - Mood ft. Iann Dior Why you always in a mood .mp32022-08-08 06:40 0  
[SND]dangdut1.mp32022-08-08 06:39 1.0M 
[SND]dangdut.mp32022-08-08 06:38 2.5M 
[SND]One Piece - Overtaken 720p HD.mp32022-08-08 06:37 0  
[SND]RAINBOE.mp32022-08-08 06:35 0  
[SND]kuz9ka-ya-sipuyu-lin.mp32022-08-08 06:35 180K 
[VID]02257501d1c059a2aad2eeed138746a7.mp42022-08-08 06:34 52K 
[SND]sample-3s.mp32022-08-08 06:33 51K 
[SND]manifest.mp32022-08-08 06:33 3.5M 
[SND]Boy Pablo - Best of Playlist-[onlinevideoconverter.com].mp32022-08-08 06:31 0  
[SND]videoplayback_2-[onlinevideoconverter.com].mp32022-08-08 06:31 38M 
[SND]FEEL KOPLO HITS Remix 2020.mp32022-08-08 06:30 5.3M 
[SND]coyote theory - this side of paradise [slowed + reverb].mp32022-08-08 06:30 0  
[SND]DJ LO MATI GUE PARTY COY SAMPE BAWAH SOUND KANE FYP TIKTOK JEDAG JEDUG FULLBASS 2022.mp32022-08-08 06:30 7.0M 
[SND]skinnyfabs - happy (audio).mp32022-08-08 06:30 4.7M 
[SND]LAGU THAILAND OK ARE YOU READY -- TIKTOK VIRAL-[onlinevideoconverter.com].mp32022-08-08 06:30 4.2M 
[SND]DJ MENEKETEHE X STENDING MOTOR X BANGUN TIDUR SELFIE MENGKANE-[onlinevideoconverter.com].mp32022-08-08 06:30 0  
[SND]y2mate.com - DJ SIKOK BAGI DUO REMIX PALEMBANG JEDAG JEDUG MENGKANE VIRAL TIKTOK.mp32022-08-08 06:30 0  
[SND]pengen gitu gituan.mp32022-08-08 06:28 0  
[SND]pestarakyat.mp32022-08-08 06:28 0  
[SND]nuha_bahrin_naufal_azrin_casablanca_official_music_video_8845422238622974089.mp32022-08-08 06:25 2.9M 
[SND]happy5.mp32022-08-08 06:23 0  
[SND]METAN - Шнурки (Шнурки).mp32022-08-08 06:18 0  
[SND]happy1.mp32022-08-08 06:12 0  
[SND]bumer.mp32022-08-08 06:11 0  
[SND]pengen.mp32022-08-08 06:08 0  
[SND]1580241685_gorky-park-moscow-calling.mp32022-08-08 06:05 0  
[SND]COLA.mp32022-08-08 06:04 0  
[SND]thallumala.mp32022-08-08 06:03 0  
[SND]Sunroof.mp32022-08-08 06:03 0  
[SND]MARRYME.mp32022-08-08 06:00 3.4M 
[SND]Rill3.mp32022-08-08 05:59 0  
[SND]cinta.mp32022-08-08 05:59 3.5M 
[SND]Rill2.mp32022-08-08 05:58 0  
[SND]Rill1.mp32022-08-08 05:58 0  
[SND]someday.mp32022-08-08 05:56 0  
[SND]maybe.mp32022-08-08 05:56 0  
[SND]lagu 1.mp32022-08-08 05:47 0  
[SND]houseelectrified.mp32022-08-08 05:47 0  
[SND]MMK10.mp32022-08-08 05:46 0  
[SND]dubstepd.mp32022-08-08 05:44 0  
[SND]mp3juice1s.cc - DJ RIP LOVE FAOUZIA REMIX TERBARU FULL BASS DJ Opus (128kbps).mp32022-08-08 05:43 0  
[SND]audiohub__4066141022963_loveless__testversion.mp32022-08-08 05:43 0  
[SND]audiohub__4066141007229_true-dreams__testversion.mp32022-08-08 05:43 0  
[SND]audiohub__4066141014685_inside-me__testversion.mp32022-08-08 05:43 0  
[SND]audiohub__4066141017754_sip-your-heart-out__testversion.mp32022-08-08 05:43 0  
[SND]audiohub__4066141016238_all-good-things__testversion.mp32022-08-08 05:43 0  
[SND]54.mp32022-08-08 05:39 0  
[SND]ari1.mp32022-08-08 05:36 0  
[SND]7039057277080324866.mp32022-08-08 05:34 0  
[SND]staplegun-bin-bonkers_456246340.mp32022-08-08 05:33 0  
[SND]miyagi-andy-panda-patron-mp3.mp32022-08-08 05:30 8.6M 
[SND]CNB4.mp32022-08-08 05:30 0  
[SND]UJAN.mp32022-08-08 05:27 4.6M 
[SND]TOBAT.mp32022-08-08 05:27 2.5M 
[SND]SED2.mp32022-08-08 05:27 2.5M 
[SND]SED1.mp32022-08-08 05:26 3.2M 
[SND]PDI.mp32022-08-08 05:26 0  
[SND]uify.mp32022-08-08 05:26 0  
[SND]NGRP1.mp32022-08-08 05:26 0  
[SND]ARA.mp32022-08-08 05:25 0  
[SND]50 Cent _rmx.mp32022-08-08 05:25 0  
[SND]MONS - Labass ft flenn ( Official Music Video )(MP3_70K).mp32022-08-08 05:25 2.1M 
[SND]8.mp32022-08-08 05:24 0  
[SND]7.mp32022-08-08 05:24 0  
[SND]Neulovimyjj_-_A_po_rajjonu_brodit_parnishka_72536174.mp32022-08-08 05:24 0  
[SND]Beethoven - For Elise (Für Elise), Bagatelle No. 25 in A minor.mp32022-08-08 05:21 0  
[SND]7059594761958591259.mp32022-08-08 05:17 0  
[SND]Девочка Оскар (Dj GLAZUR Remix).mp32022-08-08 05:16 0  
[SND]tiktok1659935553675.mp32022-08-08 05:14 0  
[SND]panaloezmill.mp32022-08-08 05:11 0  
[SND]Genjer1.mp32022-08-08 05:11 0  
[SND]tiktok1659928111013.mp32022-08-08 05:10 0  
[SND]👑Bass prod.by Tolik_Beats👑 - Красный сарафан.mp32022-08-08 05:08 0  
[SND]𝙱𝙴𝚂𝙸𝙺.𝟻𝟶𝟶🤺 - связался с пиратами. (www.hotplayer.ru).mp32022-08-08 05:08 0  
[SND]meomeowie4.mp32022-08-08 05:02 0  
[SND]cheb Rami ana nbgi.dj rafik.mp32022-08-08 05:01 0  
[SND]Manik.mp32022-08-08 04:58 0  
[SND]MONEYKEN LOVE.mp32022-08-08 04:47 0  
[SND]Banding.mp32022-08-08 04:32 0  
[VID]lv_7128815052555177217_20220807172223.mp42022-08-08 04:31 0  
[SND]Ingay.mp32022-08-08 04:28 0  
[SND]walkie-talkie-turn-on-beep-SBA-300149699-preview.mp32022-08-08 04:26 0  
[SND]DJ-CAMPURAN-FYP-TIKTOK-VIRAL-TERBARU-JEDAG-JEDUG-FULL-BASS-MENGKANE-2022_uIqdNZJmfpM.mp32022-08-08 04:22 0  
[SND]CLOSE-YOUR-EYE-X-BANGUN-TIDUR-SELFI-X-GO-SAMPE-BAWAH-Slowed-Version_6ab21EuYXRM.mp32022-08-08 04:17 0  
[SND]djsans.mp32022-08-08 04:13 0  
[SND]blexed.mp32022-08-08 04:10 960K 
[SND]Zpartan9.mp32022-08-08 04:06 1.9M 
[VID]5fa0fd6f-f5ee-6aca-e44d-1cf6cb661808_custom.mp42022-08-08 04:04 0  
[SND]Deathnote.mp32022-08-08 04:04 0  
[SND]Hamdeh.mp32022-08-08 04:00 0  
[SND]Survival1.mp32022-08-08 03:59 0  
[SND]Arcade3.mp32022-08-08 03:58 0  
[SND]felicitacionCorregida.mp32022-08-08 03:57 0  
[SND]Arcade2.mp32022-08-08 03:55 2.6M 
[SND]MidgeUreTheManWhoSoldtheWorld.mp32022-08-08 03:52 0  
[SND]Hot Freaks-Puppy-Princess.mp32022-08-08 03:52 0  
[SND]CrystalCastles-Vanished.mp32022-08-08 03:51 0  
[SND]Geneburn-Countdown.mp32022-08-08 03:51 0  
[SND]Sova-pervii-sneg.mp32022-08-08 03:51 0  
[SND]Yanka-Na-cherni-den.mp32022-08-08 03:51 0  
[SND]Sos-Sam-po-sebe.mp32022-08-08 03:51 0  
[SND]Nauchnii-Sotrudnik-Gadkaya-bogema.mp32022-08-08 03:51 0  
[SND]Titanium-Mittsies.mp32022-08-08 03:51 0  
[SND]Lil-Darkie-rapmusic.mp32022-08-08 03:51 1.8M 
[SND]Arcade1.mp32022-08-08 03:49 2.4M 
[SND]oteyz.mp32022-08-08 03:46 0  
[SND]devilindehos.mp32022-08-08 03:45 0  
[SND]Omar_Rising_Aisha_Saeed_z-lib.org.mp32022-08-08 03:42 0  
[SND]kasal.mp32022-08-08 03:36 3.4M 
[SND]Sunflower.mp32022-08-08 03:21 3.6M 
[SND]21guns.mp32022-08-08 03:20 0  
[SND]thuyenquyen.mp32022-08-08 03:11 0  
[SND]Moresex.m4a2022-08-08 03:09 0  
[SND]Circles.mp32022-08-08 03:08 0  
[SND]y2mate.com - TRICKSTER ANTHEM Official Music Video.mp32022-08-08 03:07 0  
[SND]MohamedZhani.mp32022-08-08 03:06 0  
[SND]VINH.mp32022-08-08 03:03 0  
[SND]VinhVINAMILK.mp32022-08-08 03:01 0  
[SND]3mo Zhani.mp32022-08-08 02:55 0  
[SND]MOHAMED_ZHANI.m4a2022-08-08 02:52 0  
[SND]Inkonnu - CHILL ( OFFICIAL LYRIC VIDEO) Prod by _ RESSAY(M4A_128K).m4a2022-08-08 02:50 0  
[SND]Kara Deri - Вернёшься (ThreeV Remix)(1).mp32022-08-08 02:44 0  
[SND]20220808_102434.m4a2022-08-08 02:36 0  
[SND]Died.mp32022-08-08 02:26 0  
[SND]CrystalCastlesVanished.mp32022-08-08 02:25 0  
[SND]Science.mp32022-08-08 02:25 0  
[SND]TitaniumMittsies.mp32022-08-08 02:25 0  
[SND]MidgeUreThe ManWhoSoldtheWorld.mp32022-08-08 02:25 0  
[SND]Owl.mp32022-08-08 02:25 0  
[SND]HotFreaksPuppyPrincess.mp32022-08-08 02:25 0  
[SND]semalam.mp32022-08-08 02:24 952K 
[SND]AUD-20220716-WA0003.mp32022-08-08 02:22 0  
[SND]Lil Darkierapmusic.mp32022-08-08 02:21 0  
[SND]Yanka(Remastered).mp32022-08-08 02:21 0  
[SND]Science .mp32022-08-08 02:21 0  
[SND]Midge UreThe ManWhoSoldtheWorld.mp32022-08-08 02:21 0  
[SND]Geneburn (2).mp32022-08-08 02:21 0  
[SND]Hot FreaksPuppyPrincess.mp32022-08-08 02:21 0  
[SND]y2meta.com - Ta Say - APJ x Helia x Masew (128 kbps).mp32022-08-08 02:13 0  
[SND]ahmadshamal44.mp32022-08-08 02:07 0  
[SND]niko21.mp32022-08-08 02:03 0  
[SND]Habangb.mp32022-08-08 02:02 0  
[SND]inbound4367460822511391083.mp32022-08-08 02:01 0  
[SND]Dangdutan.mp32022-08-08 01:47 0  
[SND]ahmadshamal21.mp32022-08-08 01:44 0  
[SND]nevermind.mp32022-08-08 01:44 0  
[SND]sadr2444.mp32022-08-08 01:43 0  
[SND]Sting weed love song _Audio_766611_Bass Booster(1).mp32022-08-08 01:39 0  
[SND]music_test2_منوعات الديدجي_اغاني-جزائرية_Cheb Faudil - Kont Na3tiha Masrouf.mp32022-08-08 01:33 0  
[SND]elsanokomen.mp32022-08-08 01:31 0  
[SND]galau9.mp32022-08-08 01:30 0  
[SND]NIRVANA3.mp32022-08-08 01:29 4.4M 
[SND]NIRVANA2.MP.mp32022-08-08 01:26 8.7M 
[SND]Urogeh4.mp32022-08-08 01:22 5.8M 
[SND]NIRVANA1.mp32022-08-08 01:21 4.6M 
[SND]setfire.mp32022-08-08 01:17 3.4M 
[SND]tune.mp32022-08-08 01:17 2.6M 
[SND]buadi.mp32022-08-08 01:13 4.2M 
[SND]rotchovoibotsaulo.mp32022-08-08 01:13 2.9M 
[SND]cua.mp32022-08-08 01:13 3.0M 
[SND]lucnho.mp32022-08-08 01:13 2.4M 
[SND]cotienxanh.mp32022-08-08 01:13 6.8M 
[SND]choi.mp32022-08-08 01:13 3.9M 
[SND]maskoff.mp32022-08-08 01:13 4.5M 
[SND]give.mp32022-08-08 01:13 3.6M 
[SND]rolling.mp32022-08-08 01:13 2.9M 
[SND]muonchoitao.mp32022-08-08 01:13 4.9M 
[SND]121.mp32022-08-08 01:13 1.9M 
[SND]thanhxuan.mp32022-08-08 01:13 3.4M 
[SND]dat.mp32022-08-08 01:13 2.0M 
[SND]ikigai.mp32022-08-08 01:13 3.7M 
[SND]industrybaby.mp32022-08-08 01:13 3.2M 
[SND]nhumotnhangia.mp32022-08-08 01:13 4.8M 
[SND]drill.mp32022-08-08 01:13 2.4M 
[SND]what.mp32022-08-08 01:13 2.1M 
[SND]thuyenvang.mp32022-08-08 01:13 4.2M 
[SND]homieweed.mp32022-08-08 01:13 6.2M 
[SND]nhungmonde.mp32022-08-08 01:13 3.2M 
[SND]lamthem.mp32022-08-08 01:13 3.1M 
[SND]tien.mp32022-08-08 01:13 3.1M 
[SND]godfaher.mp32022-08-08 01:13 2.6M 
[SND]galau8.mp32022-08-08 01:12 2.4M 
[SND]galau7.mp32022-08-08 01:03 4.3M 
[SND]Poker Face - Lady Gaga (Lyrics).mp32022-08-08 01:03 0  
[SND]fahrezy2.mp32022-08-08 01:02 280K 
[SND]Y2Mate.is - Bitches - MSI ★ [SPED UPNIGHTCORE]-zwfhtdUllmY-160k-1659850548255.mp32022-08-08 00:49 0  
[SND]REYNE.mp32022-08-08 00:46 0  
[SND]Y2Mate.is - nico's nextbots music stepback - nicopatty feat deet sped up + high pitch-ePP0lhYgaSY-128k-1659262886931.mp32022-08-08 00:45 0  
[SND]fahrezy1.mp32022-08-08 00:31 4.9M 
[SND]Rob.mp32022-08-08 00:31 519K 
[SND]tiMO21.mp32022-08-08 00:28 2.5M 
[SND]galau6.mp32022-08-08 00:22 4.4M 
[SND]galau5.mp32022-08-08 00:19 3.4M 
[SND]WRAITH2.mp32022-08-08 00:19 1.2M 
[SND]O que é mulher.mp32022-08-08 00:18 287K 
[SND]galau3.mp32022-08-08 00:16 3.5M 
[SND]galau2.mp32022-08-08 00:12 3.0M 
[SND]galau1.mp32022-08-08 00:07 3.4M 
[SND]Ralph - Tables Have Turned (Lyrics).mp32022-08-08 00:07 0  
[SND]y2meta (mp3cut.net).mp32022-08-08 00:02 0  
[SND]Dhije290.mp32022-08-07 23:58 0  
[SND]Galau.mp32022-08-07 23:57 3.8M 
[SND]ncomment.mp32022-08-07 23:56 2.8M 
[SND]SAD8.mp32022-08-07 23:44 0  
[SND]dhije29.mp32022-08-07 23:39 0  
[SND]byeji.mp32022-08-07 23:26 0  
[SND]kgnikmakino.mp32022-08-07 23:21 0  
[SND]Миронов🥀 - бандит [slow + remix].mp32022-08-07 23:17 0  
[SND]IV_OF_SPADES_-_Where_Have_You_Been,_My_Disco?_(Official_Video)(256k).mp32022-08-07 23:12 0  
[SND]onlymp3.to - Epic Celtic Battle Music - Battle For Camelot (Tartalo Music)-NBpu3Fhvkdc-192k-1659913791956.mp32022-08-07 23:11 0  
[SND]dora_-_Dora_dura_67181158.mp32022-08-07 23:00 0  
[SND]yoksun.mp32022-08-07 22:58 0  
[SND]avicii.mp32022-08-07 22:56 0  
[SND]aviciitriangle.mp32022-08-07 22:53 0  
[SND]STORMY - AFRICAIN (Prod. VBGotHeat) (Lyrics Video).mp32022-08-07 22:52 0  
[SND]cheb Rami ana nbgi.. zin💥🖤 dj rafik.mp32022-08-07 22:50 0  
[SND]Through_The_Flames🎵Most Epic Music Inspiring🎼Epic Music Adventure.mp32022-08-07 22:47 0  
[SND]انا مريول..ونبغي..زينcheb Rami ana nbgi.. zin💥🖤 dj rafik.mp32022-08-07 22:46 240K 
[SND]alasa.mp32022-08-07 22:39 0  
[SND]WEADING.mp32022-08-07 22:34 0  
[SND]Indila_-_Tourner_Dans_Le_Vide_48105407 (1).mp32022-08-07 22:24 0  
[SND]Люблю Мариночку.mp32022-08-07 22:21 0  
[SND]Nenad1.mp32022-08-07 22:17 0  
[SND]xd.mp32022-08-07 22:13 0  
[SND]THRILL_PILL_-_YA_ne_rebjonok_53420169.mp32022-08-07 22:12 0  
[SND]Казённый унитаз — Моча съела говно (www.lightaudio.ru).mp32022-08-07 22:11 0  
[SND]xo.mp32022-08-07 22:05 0  
[SND]y2meta.com - KXNVRA - BLOWIN' (128 kbps).mp32022-08-07 22:04 0  
[SND]-Full HD- Hoshizora Monogatari - Nana Takahashi(MP3_320K).mp32022-08-07 21:55 0  
[SND]nast0715.mp32022-08-07 21:53 0  
[SND]hdn0715.mp32022-08-07 21:50 0  
[SND]xj.mp32022-08-07 21:46 0  
[SND]mixkit-game-show-suspense-waiting-667.mp32022-08-07 21:40 0  
[SND]Ебанько - Денег нету.mp32022-08-07 21:35 0  
[SND]VTORNIK - Макака.mp32022-08-07 21:33 0  
[SND]Tu sicaria - Ms Nina letra (NUEVOEXITO.ORG).mp32022-08-07 21:28 0  
[SND]Arabesque -friday night hit disco 1978.mp32022-08-07 21:27 0  
[SND]Ratt - Round And Round - HQ Audio (NUEVOEXITO.ORG).mp32022-08-07 21:26 0  
[SND]teman.mp32022-08-07 21:22 2.9M 
[SND]Simple Plan - Iconic.mp32022-08-07 21:22 0  
[SND]phonkz.mp32022-08-07 21:18 0  
[SND]Sad39.mp32022-08-07 21:15 0  
[SND]Dreaming Up! The Master Mix-[AudioTrimmer.com].mp32022-08-07 21:04 0  
[SND]Sad7.mp32022-08-07 21:04 0  
[SND]GOOD.mp32022-08-07 21:02 3.7M 
[SND]SGT.MP.mp32022-08-07 21:02 0  
[SND]LUCY.mp32022-08-07 21:02 0  
[SND]Berdua.mp32022-08-07 21:01 0  
[SND]mala.mp32022-08-07 20:58 0  
[SND]he-he-he-haw (1).mp32022-08-07 20:52 0  
[SND]3.Lucy In The Sky With Diamonds (Remastered 2009).mp32022-08-07 20:49 2.7M 
[SND]1. Sgt. Pepper's Lonely Hearts Club Band (Remastered 2009).mp32022-08-07 20:48 0  
[SND]Fear of the Dark (2015 - Remaster).mp32022-08-07 20:44 0  
[SND]Fear of the Dark (2015 Remaster) (1).mp32022-08-07 20:42 0  
[SND]LSD X .mp32022-08-07 20:27 0  
[SND]Я люблю газ давать.mp32022-08-07 20:16 0  
[SND]brown.mp32022-08-07 20:15 1.8M 
[SND]BIFFGUYZ - Чики.mp32022-08-07 20:13 0  
[SND]kk.mp32022-08-07 20:04 3.7M 
[SND]ff.mp32022-08-07 20:02 2.0M 
[SND]joyy1.mp32022-08-07 20:01 0  
[SND](AOB) (23-26Hz) Waka Flocka Flame feat. Popa Smurf, Slim Dunkin, YG Hootie - Karma (screwed and lb by 400kg) (1).mp32022-08-07 19:55 0  
[SND]Fear of the Dark (2015 Remaster).mp32022-08-07 19:50 0  
[SND]videoplayback (1) (online-video-cutter.com) (1).mp32022-08-07 19:46 0  
[SND]lofisong.mp32022-08-07 19:45 4.0M 
[SND]putanginamo.mp32022-08-07 19:44 1.3M 
[SND]starset_my_demons.mp32022-08-07 19:40 0  
[SND]Joykontol1.mp32022-08-07 19:36 0  
[SND]djkontolomeledak1.mp32022-08-07 19:34 0  
[SND]ADT1.mp32022-08-07 19:33 0  
[SND]Sad10.mp32022-08-07 19:32 204K 
[SND]Aircheck 1-23 Purdum.mp32022-08-07 19:30 0  
[SND]genjer.mp32022-08-07 19:26 4.1M 
[SND]Green Day - The Simpsons Theme.mp32022-08-07 19:21 0  
[SND]radif.mp32022-08-07 19:20 28K 
[SND]breaking_benjamin_angels_fall_official_video_-5030218190492747930.mp32022-08-07 19:20 3.7M 
[SND]arabtik.mp32022-08-07 19:16 0  
[SND]Баста - Моя игра (feat. Guf).mp32022-08-07 19:16 0  
[SND]sayaa.mp32022-08-07 19:15 0  
[SND]Breaking Benjamin - Angels Fall (Official Video).mp32022-08-07 19:13 0  
[SND]album4.mp32022-08-07 19:13 0  
[SND]smoraxan.mp32022-08-07 19:11 2.1M 
[SND]Jun.mp32022-08-07 19:07 0  
[SND]Zaalima .mp32022-08-07 19:03 0  
[SND]Sak3.mp32022-08-07 18:59 0  
[SND]Milica Pavlovic Feat. Albino - Seceru (RichMee Remix).mp32022-08-07 18:59 0  
[SND]Saiyaara [Slowed+Reverb] - Mohit Chauhan _ Musiclovers _ Textaudio.mp32022-08-07 18:56 0  
[SND]elTRTR.mp32022-08-07 18:52 0  
[SND]y2mate.com - DJ SIKOK BAGI DUO BASS BETON X SADARKAH KASIH SCS ENTERTAINMENT VIRAL FYP TIKTOK 2022.mp32022-08-07 18:48 0  
[SND]Виталя[Джа]_(Витя_матанга)_-_Чё-то_типа_жизнь_проходит_мимо_(mp3shnik.ru).mp32022-08-07 18:40 0  
[SND]Topeng.mp32022-08-07 18:39 0  
[SND]Juan16.mp32022-08-07 18:38 0  
[SND]Breskvica - Losa (BackBoy & DJ Boky Mashup) #balkania.mp32022-08-07 18:37 0  
[SND]colocando_e_travando_cinto_de_seguran_a_seatbelt_sfx_-4786453905378444572.mp32022-08-07 18:33 0  
[SND]NGANGEN (SAWAL JAWA).mp32022-08-07 18:30 0  
[SND]AKHIRE LUNGO (IKY JAWA).mp32022-08-07 18:30 0  
[SND]Old banh.m4a2022-08-07 18:30 0  
[SND]LAYANG DUNGO RESTU (IKY JAWA).mp32022-08-07 18:30 0  
[SND]Lag .mp32022-08-07 18:28 0  
[SND]reda.mp32022-08-07 18:21 0  
[SND]Armada4.mp32022-08-07 18:17 0  
[SND]Armada3.mp32022-08-07 18:17 0  
[SND]Armada5.mp32022-08-07 18:17 0  
[SND]azizzorgani.mp32022-08-07 18:16 0  
[SND]Armada2.mp32022-08-07 18:16 0  
[SND]kiyo2.mp32022-08-07 18:04 0  
[SND]ahah1.mp32022-08-07 18:00 0  
[SND]Ace Banzuelo Muli Official Lyric Video.mp32022-08-07 17:56 0  
[VID]Jed Pineda.mp42022-08-07 17:52 0  
[SND]ishan3.mp32022-08-07 17:49 0  
[SND]a.mp32022-08-07 17:48 428K 
[SND]GAYAZOV_BROTHER_-_MALINOVAYA_LADA_73214200.mp32022-08-07 17:46 0  
[SND]kakaobelogocveta.mp32022-08-07 17:46 0  
[SND]Cover.mp32022-08-07 17:42 0  
[SND]2523-09864-12489.mp32022-08-07 17:42 0  
[SND]Foufa Torino X Didine Canon 16 X Kader Japonais - Lwalida (Official Music Video)(MP3_320K).mp32022-08-07 17:41 0  
[SND]2523-09864-12489-69402-459630.mp32022-08-07 17:41 0  
[SND]Elisa_Lost_into_the_Night_(Initial_D_1st_Stage _D_Selection 2_)_(www.lightaudio.ru).mp32022-08-07 17:40 0  
[SND]Jsg.mp32022-08-07 17:40 0  
[SND]dvoreckov-vpika_(mp3IQ.net).mp32022-08-07 17:40 0  
[SND]20181226_200624.mp32022-08-07 17:39 0  
[SND]Kakao_belogo_cveta-soft nightcore-nightcore_bassboost.mp32022-08-07 17:38 0  
[SND]kakaobelogo.mp32022-08-07 17:37 1.1M 
[SND]yo-voy_(mp3IQ.net)(mailbox).mp32022-08-07 17:36 0  
[SND]yo-voy.mp32022-08-07 17:35 0  
[SND]dvoreckov-vpiska_(mp3IQ.net).mp32022-08-07 17:33 1.6M 
[SND]Vip6.mp32022-08-07 17:32 3.6M 
[SND]kakao-belogo-cveta.mp32022-08-07 17:32 0  
[SND]214kakao.mp32022-08-07 17:31 0  
[SND]JALA BRAT X BUBA CORRELI - PILULA.mp32022-08-07 17:27 0  
[SND]Pyrokinesis_-_YA_pridu_k_tebe_s_klubnikojj_v_dekabre_55936377.mp32022-08-07 17:27 0  
[SND]1kgkakao.mp32022-08-07 17:26 468K 
[SND]JALA BRAT X BUBA CORRELI - PILULA (SOUNDADDICTS MASHUP)#Balkania.mp32022-08-07 17:25 3.3M 
[SND]X2Download.com - ꧁☆(☢‿☢)☆꧂ - Какао белого цвета (Nightcore) (192 kbps).mp32022-08-07 17:23 0  
[SND]Nagumo.mp32022-08-07 17:22 0  
[SND]какао белого цвета.mp32022-08-07 17:21 4.3M 
[SND]Неизвестен - Без названия.mp32022-08-07 17:20 4.3M 
[SND]sholawat.mp32022-08-07 17:20 2.0M 
[SND]Isa - Andro (Lyrics) _ andro _ _ sonnaya lunnaya .mp32022-08-07 17:19 0  
[SND]Vitamin_String_Quartet_J_Hisaishi_-_Howls_Moving_Castle_-_Merry_Go_Round_of_Life_51057163.mp32022-08-07 17:19 0  
[SND]Lizer_-_Pachka_sigaret_57408715.mp32022-08-07 17:19 6.5M 
[SND]Poyi1.mp32022-08-07 17:15 0  
[SND]risk.mp32022-08-07 17:15 2.6M 
[SND]Vip5.mp32022-08-07 17:15 2.3M 
[SND]Be Notorious (Title Track).mp32022-08-07 17:09 0  
[SND]this-is-war-loopable-95413.mp32022-08-07 17:09 0  
[SND]Sad23.mp32022-08-07 17:09 0  
[SND]juned1.mp32022-08-07 17:08 0  
[SND]y2mate.com - DJ CAMPURAN VIRAL TIKTOK 2022 JEDAG JEDUG FULL BASS TERBARU (1).mp32022-08-07 17:07 0  
[SND]deaaa.mp32022-08-07 17:07 0  
[SND]WindRoseDiggyDiggyHole64868093.mp32022-08-07 17:06 0  
[SND]04.mp32022-08-07 17:04 1.3M 
[SND]daa.mp32022-08-07 17:03 0  
[SND]diverfon.mp32022-08-07 17:02 0  
[SND]demtan.mp32022-08-07 17:00 0  
[SND]saddamm.mp32022-08-07 16:55 960K 
[SND]luffy1.mp32022-08-07 16:54 0  
[SND]DJz.mp32022-08-07 16:50 0  
[SND]thumbi.mp32022-08-07 16:49 0  
[SND]Sunset.mp32022-08-07 16:40 0  
[SND]kopet.mp32022-08-07 16:39 0  
[SND]XyorXzz.mp32022-08-07 16:35 0  
[SND]vikraem.mp32022-08-07 16:33 0  
[SND]yt1s.io - (Drunk in a shaappu) മലയാളം song remix (DJ MALAYALAM) drank song BOOSTED BASS By SKULL FORCE (128 kbps).mp32022-08-07 16:30 0  
[SND]vikrem.mp32022-08-07 16:26 0  
[SND]KiwKiw1.mp32022-08-07 16:24 0  
[SND]Sad6.mp32022-08-07 16:24 1.1M 
[SND]Sad4.mp32022-08-07 16:23 5.8M 
[SND]Dhije24.mp32022-08-07 16:23 0  
[SND]Har.mp32022-08-07 16:22 0  
[SND]EMEL.mp32022-08-07 16:21 4.7M 
[SND]Har Har Shambhu Ringtone_320(PagalWorld.com.se).mp32022-08-07 16:20 0  
[SND]Dhijee29.mp32022-08-07 16:20 0  
[SND]Ajith2.mp32022-08-07 16:17 0  
[SND]lemon.mp32022-08-07 16:16 1.9M 
[SND]Ajith1.mp32022-08-07 16:14 848K 
[SND]y2mate.com - Keisya Levronka Tak Ingin Usai Official Music Video.mp32022-08-07 16:08 0  
[SND]TDYSG1.mp32022-08-07 16:06 0  
[SND]Reality.mp32022-08-07 16:06 0  
[SND]IFA.mp32022-08-07 16:05 0  
[SND]Soft.mp32022-08-07 16:05 0  
[SND]DUDE120.mp32022-08-07 16:04 0  
[SND]DjOld.mp32022-08-07 16:03 0  
[SND]OneDirection1.mp32022-08-07 16:01 0  
[SND]meong.mp32022-08-07 15:58 0  
[SND]pup.mp32022-08-07 15:58 0  
[SND]02.mp32022-08-07 15:58 18M 
[SND]SARAK1.mp32022-08-07 15:48 1.9M 
[SND]128-Why This Kolaveri Di (The Soup of Love) - 3 128 Kbps.mp32022-08-07 15:41 0  
[SND]semalam1.mp32022-08-07 15:40 0  
[SND]XXX.mp32022-08-07 15:40 300K 
[SND]Hank1.mp32022-08-07 15:39 4.0M 
[SND]DjSoft.mp32022-08-07 15:39 0  
[SND]Endshpil_Oj_oj_oj_nesi_menya_moya_doroga.mp32022-08-07 15:37 0  
[SND]ya69.mp32022-08-07 15:36 0  
[SND]didto.mp32022-08-07 15:36 0  
[SND]Pflegekennzeichnung.mp32022-08-07 15:35 0  
[SND]A Pimp Named Slickback.mp32022-08-07 15:34 0  
[SND]yt1s.com - Rollinin In The Rearview Headbone ft Jabu Cars Delinquent Road Hazards Song HD 2 1 Audio.mp32022-08-07 15:32 0  
[SND]miyagi-jendshpil-feat.-9-gramm-rapapam.mp32022-08-07 15:32 0  
[SND]tm23.mp32022-08-07 15:32 0  
[SND]tm14.mp32022-08-07 15:32 4.1M 
[SND]tm20.mp32022-08-07 15:32 4.4M 
[SND]tm17.mp32022-08-07 15:32 6.5M 
[SND]tm19.mp32022-08-07 15:32 3.3M 
[SND]tm18.mp32022-08-07 15:32 2.4M 
[SND]tm15.mp32022-08-07 15:32 0  
[SND]tm10.mp32022-08-07 15:32 3.7M 
[SND]tm13.mp32022-08-07 15:32 3.0M 
[SND]tm12.mp32022-08-07 15:32 4.7M 
[SND]tm9.mp32022-08-07 15:32 2.8M 
[SND]tm11.mp32022-08-07 15:32 4.1M 
[SND]tm8.mp32022-08-07 15:32 2.9M 
[SND]tm5.mp32022-08-07 15:32 7.3M 
[SND]tm6.mp32022-08-07 15:32 6.7M 
[SND]tm7.mp32022-08-07 15:32 3.4M 
[SND]tm4.mp32022-08-07 15:32 8.8M 
[SND]tm3.mp32022-08-07 15:32 6.6M 
[SND]tm2.mp32022-08-07 15:32 7.7M 
[SND]tm1.mp32022-08-07 15:32 10M 
[SND]Sepaa.mp32022-08-07 15:31 0  
[SND]Beautifuliw.mp32022-08-07 15:28 0  
[SND]johns.mp32022-08-07 15:27 0  
[SND]Before.mp32022-08-07 15:24 0  
[SND]SEE70.mp32022-08-07 15:23 0  
[SND]Riddle Relient K cover.mp32022-08-07 15:22 0  
[SND]Miyagi_Simptom_-_Lyubi_menya_47829531.mp32022-08-07 15:22 0  
[SND]Good12.mp32022-08-07 15:18 0  
[SND]arctic monkeys — why'd you only call me when you're high (slightly slowed) (www.lightaudio.ru).mp32022-08-07 15:17 0  
[SND]Slippy & Blosso - Horizon (Back To Life) [Official Instrumental].mp32022-08-07 15:16 0  
[SND]Instasamka_Хлопай_[BASS BOOSTED]_(256_kbps).mp32022-08-07 15:16 0  
[SND]Neizvestnyjj_-_INSTASAMKA-KHLOPAJJ_BASS_BOOST_73386954 (1).mp32022-08-07 15:16 0  
[SND]Wuxa Song.mp32022-08-07 15:15 0  
[SND]Chase_Atlantic_-_CALL_ME_BACK_73217790.mp32022-08-07 15:15 0  
[SND]decemberave.mp32022-08-07 15:15 0  
[SND]7! (mp3cut.net).mp32022-08-07 15:15 0  
[SND]naz.mp32022-08-07 15:14 0  
[SND]Hero12.mp32022-08-07 15:14 0  
[SND]Beautiful in white (.mp32022-08-07 15:13 0  
[SND]Instasamka - Хлопай [BASS BOOSTED] (256 kbps).mp32022-08-07 15:13 3.4M 
[SND]DUDE116.mp32022-08-07 15:07 3.3M 
[SND]john_mayer_you_re_gonna_live_forever_in_me_audio_4683622890228229170.mp32022-08-07 15:06 0  
[SND]DUDE95.mp32022-08-07 15:06 3.7M 
[SND]mercury.mp32022-08-07 15:04 0  
[SND]y2mate.com - One Direction Night Changes Lyrics.mp32022-08-07 15:04 2.7M 
[SND]dije1.mp32022-08-07 15:03 3.8M 
[SND]Avraham (1).mp32022-08-07 15:01 0  
[SND]alina-shakieva-ujkym-kelmejdi_(muzstars.kz).mp32022-08-07 15:01 0  
[SND]Lil.mp32022-08-07 15:00 0  
[SND]FizGegeh.mp32022-08-07 14:59 0  
[SND]DUDE98.mp32022-08-07 14:58 2.6M 
[SND]DUDE97.mp32022-08-07 14:58 4.6M 
[SND]DUDE90.mp32022-08-07 14:58 2.0M 
[SND]DUDE93.mp32022-08-07 14:58 3.3M 
[SND]DUDE94.mp32022-08-07 14:58 4.4M 
[SND]DUDE99.mp32022-08-07 14:58 2.5M 
[SND]DUDE96.mp32022-08-07 14:58 2.6M 
[SND]DUDE84.mp32022-08-07 14:58 5.0M 
[SND]DUDE91.mp32022-08-07 14:58 3.4M 
[SND]DUDE9.mp32022-08-07 14:58 3.5M 
[SND]DUDE92.mp32022-08-07 14:58 2.4M 
[SND]DUDE89.mp32022-08-07 14:58 3.0M 
[SND]DUDE88.mp32022-08-07 14:58 2.9M 
[SND]DUDE81.mp32022-08-07 14:58 3.9M 
[SND]DUDE83.mp32022-08-07 14:58 3.5M 
[SND]DUDE87.mp32022-08-07 14:58 2.4M 
[SND]DUDE85.mp32022-08-07 14:58 2.4M 
[SND]DUDE86.mp32022-08-07 14:58 2.5M 
[SND]DUDE82.mp32022-08-07 14:58 2.5M 
[SND]haylee.mp32022-08-07 14:58 0  
[SND]Mar.mp32022-08-07 14:58 0  
[SND]youandi.mp32022-08-07 14:56 0  
[SND]Mon.mp32022-08-07 14:56 1.4M 
[SND]Remixer12.mp32022-08-07 14:55 0  
[SND]DUDE79.mp32022-08-07 14:55 3.7M 
[SND]DUDE80.mp32022-08-07 14:55 3.0M 
[SND]DUDE78.mp32022-08-07 14:55 3.2M 
[SND]DUDE8.mp32022-08-07 14:55 2.1M 
[SND]DUDE77.mp32022-08-07 14:55 3.8M 
[SND]DUDE74.mp32022-08-07 14:55 4.3M 
[SND]DUDE70.mp32022-08-07 14:55 3.9M 
[SND]DUDE76.mp32022-08-07 14:55 2.3M 
[SND]lalove1.mp32022-08-07 14:55 0  
[SND]DUDE73.mp32022-08-07 14:55 2.9M 
[SND]DUDE75.mp32022-08-07 14:55 3.7M 
[SND]DUDE66.mp32022-08-07 14:55 3.0M 
[SND]DUDE71.mp32022-08-07 14:55 2.3M 
[SND]DUDE6.mp32022-08-07 14:55 7.5M 
[SND]DUDE72.mp32022-08-07 14:55 2.5M 
[SND]DUDE69.mp32022-08-07 14:55 2.8M 
[SND]DUDE7.mp32022-08-07 14:55 1.5M 
[SND]DUDE67.mp32022-08-07 14:55 2.0M 
[SND]DUDE65.mp32022-08-07 14:55 3.0M 
[SND]DUDE60.mp32022-08-07 14:55 3.4M 
[SND]DUDE64.mp32022-08-07 14:55 3.4M 
[SND]DUDE63.mp32022-08-07 14:55 3.7M 
[SND]DUDE68.mp32022-08-07 14:55 2.4M 
[SND]DUDE62.mp32022-08-07 14:55 2.0M 
[SND]DUDE61.mp32022-08-07 14:55 2.9M 
[SND]DUDE